BioLiP

>protein
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRA
CLEAKNLETIEDLCERAYSAFQCLREDYEMYQNELWSHP

The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3l4l:A	119	119	1.0000	1.0000	1.0000	8.76e-87	3qme:A
2	6nbn:A	123	84	0.1765	0.1707	0.2500	7.61e-05	6ogh:A, 6oii:A, 6oii:B, 6opb:E, 6opb:F, 6opb:I
3	7tx8:A	295	93	0.2521	0.1017	0.3226	7.27e-04	7tx8:B, 7tx8:C, 7tx8:D
4	6mt7:A	230	49	0.1513	0.0783	0.3673	0.002	6mt7:B, 6mtf:A, 6mtf:B
5	3r72:A	122	98	0.2185	0.2131	0.2653	0.026
6	3nhi:A	295	62	0.1429	0.0576	0.2742	0.072	3nht:A
7	3dye:A	302	24	0.0924	0.0364	0.4583	0.65	3dzt:A
8	5epa:A	258	50	0.1429	0.0659	0.3400	1.4	5epa:B, 5epa:C, 5epa:D, 5epa:E, 5epa:F
9	7rkh:D	559	28	0.1092	0.0233	0.4643	2.4	7rkh:C, 7rkh:A, 7rkh:B, 7rl0:A, 7rl0:D, 7rl0:B, 7rl0:C, 7rl0:E, 7rl0:H, 7rl0:F, 7rl0:G, 7rl0:W, 7rl0:Z, 7rl0:X, 7rl0:Y, 7rl5:A, 7rl5:B, 7rl5:D, 7rl5:C, 7rl5:E, 7rl5:M, 7rl5:R, 7rl5:P, 7rl5:L, 7rl5:O, 7rl5:S, 7rl5:Q, 7rnl:B, 7rnl:C, 7rnl:D, 7rnl:A, 7rnl:H, 7rnl:K, 7rnl:N, 7rnl:E, 7rnl:I, 7rnl:L, 7rnl:O, 7rnl:F, 7rnl:J, 7rnl:M, 7rnl:P, 7rnl:G, 7rnr:A, 7rnr:B, 7rnr:F, 7rnr:E, 7rnr:Q, 7rnr:S, 7rnr:a, 7rnr:Y, 7rnr:I, 7rnr:J, 7rnr:N, 7rnr:M, 7rnr:R, 7rnr:T, 7rnr:b, 7rnr:Z, 7rnr:g, 7rnr:h, 7rnr:l, 7rnr:k
10	5v13:A	268	18	0.0756	0.0336	0.5000	4.8	5v13:B, 5v13:C
11	7mit:E	1438	45	0.1008	0.0083	0.2667	7.3	7mjo:E, 7mjp:E, 7mjq:E, 7y1l:A

[Back]