BioLiP

>protein
NEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVRCATQRNICQCCMLDSRWHIPIQ
LRDHLISLVVMTEEAKNDMMKRFLSLKNVKLGGAQITSDPSEADNIVDKLKNILLSFFLYNSIPEWKITDTVSQLLSLIV
NHKAKCGGLRFQSSELGERFVSKIFIIPWSTAENIKLSLSLNKLIQLEL

The query sequence (length=209) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5mps:N	227	225	1.0000	0.9207	0.9289	5.18e-143	5lj3:N, 5lj5:N, 5mq0:N
2	6exn:N	242	242	0.9952	0.8595	0.8595	3.30e-139	6bk8:F
3	7b9v:N	264	264	0.9952	0.7879	0.7879	7.52e-136
4	7dco:Q	292	288	1.0000	0.7158	0.7257	6.32e-133	6j6g:Q, 6j6h:Q, 6j6n:Q, 6j6q:Q
5	5gm6:Q	185	199	0.8182	0.9243	0.8593	1.57e-118	5gmk:Q, 5wsg:Q, 5ylz:M
6	5y88:M	182	179	0.6794	0.7802	0.7933	2.34e-95
7	3jb9:a	255	189	0.3062	0.2510	0.3386	6.74e-25
8	8ch6:U	295	101	0.1866	0.1322	0.3861	7.18e-17	7a5p:P, 8c6j:M, 6ff4:P, 6ff7:P, 9fmd:O, 8i0p:O, 8i0r:O, 8i0s:O, 8i0t:O, 8i0u:O, 8i0v:O, 8i0w:O, 6icz:O, 6id0:O, 6id1:O, 5mqf:P, 6qdv:M, 7qtt:U, 8ro2:O, 7w59:O, 7w5a:O, 7w5b:O, 5xjc:O, 5yzg:O, 5z56:O, 5z57:O, 6zym:P
9	8ro0:O	342	133	0.2105	0.1287	0.3308	8.89e-17	8ro1:O
10	7abi:P	237	79	0.1675	0.1477	0.4430	3.59e-16	7aav:P, 7abg:P
11	1sly:A	618	120	0.1244	0.0421	0.2167	0.19
12	6j6g:C	920	74	0.1053	0.0239	0.2973	0.96	7b9v:C, 6bk8:B, 7dco:C, 5gm6:C, 5gmk:C, 6j6h:C, 6j6n:C, 6j6q:C, 3jcm:H, 6teo:A, 6teo:C, 5wsg:C, 5y88:C, 5ylz:C, 5zwm:C, 5zwo:C
13	5lj3:C	882	74	0.1053	0.0249	0.2973	0.99	6exn:C, 5gam:C, 5gan:C, 5lj5:C, 5lqw:B, 5mps:C, 5mq0:C, 5nrl:C
14	7sh1:A	626	31	0.0670	0.0224	0.4516	3.5	7sh1:B
15	8h8j:C	283	28	0.0526	0.0389	0.3929	5.2
16	5dgk:A	519	44	0.0718	0.0289	0.3409	5.8	5dgk:B
17	7jyp:A	305	45	0.0861	0.0590	0.4000	7.7
18	2w41:B	507	82	0.1005	0.0414	0.2561	9.1	2w40:A, 2w40:B, 2w40:C, 2w40:D, 2w41:A
19	4r7x:A	150	81	0.0909	0.1267	0.2346	9.3	4r7x:B
20	2ghf:A	102	48	0.0622	0.1275	0.2708	9.9

[Back]