NEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQGPSYKRLPKSDTFMP
CSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEK
ANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFK
SLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPD
KERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINT
RSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAH
TLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIAL
The query sequence (length=545) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ihn:K | 598 | 594 | 0.9945 | 0.9064 | 0.9125 | 0.0 | 8iht:K |
2 | 8hxx:K | 549 | 550 | 0.9817 | 0.9745 | 0.9727 | 0.0 | 8hxy:K, 8hy0:K, 8jho:K, 8kd3:B, 8kd4:B, 8kd5:B, 8kd6:B, 8tof:A |
3 | 7yi2:A | 506 | 547 | 0.9174 | 0.9881 | 0.9141 | 0.0 | 7yi5:A |
4 | 2n2h:B | 125 | 123 | 0.1009 | 0.4400 | 0.4472 | 6.70e-31 | |
5 | 1j49:A | 332 | 74 | 0.0440 | 0.0723 | 0.3243 | 0.21 | 1j49:B |
6 | 6yw5:CC | 438 | 82 | 0.0477 | 0.0594 | 0.3171 | 0.30 | 6ywe:CC, 6ywx:CC, 6ywy:CC |
7 | 2dld:A | 337 | 72 | 0.0422 | 0.0682 | 0.3194 | 0.46 | 2dld:B |
8 | 7ye1:D | 1144 | 89 | 0.0514 | 0.0245 | 0.3146 | 5.2 | 7ye2:D |
9 | 5fqg:A | 583 | 84 | 0.0422 | 0.0395 | 0.2738 | 7.3 | 5fqh:A, 5fr0:A |
10 | 6sa4:A | 109 | 30 | 0.0183 | 0.0917 | 0.3333 | 7.9 | |
11 | 6m0w:A | 1032 | 55 | 0.0404 | 0.0213 | 0.4000 | 7.9 | 6m0v:A, 6m0x:A |
12 | 7anc:B | 314 | 78 | 0.0367 | 0.0637 | 0.2564 | 8.1 | |
13 | 2gs0:A | 115 | 65 | 0.0294 | 0.1391 | 0.2462 | 9.0 | 2l2i:A, 2lox:A, 2m14:A, 2mkr:A, 2n0y:A, 2n23:A |
14 | 6gaw:AI | 328 | 137 | 0.0587 | 0.0976 | 0.2336 | 9.3 | 5aj3:I, 5aj4:AI, 6gaz:AI, 7nqh:AI, 7nql:AI, 7nsi:AI, 7nsj:AI, 8oin:Ag, 8oip:Ag, 6ydp:AI, 6ydw:AI |
15 | 8gps:A | 228 | 37 | 0.0257 | 0.0614 | 0.3784 | 9.5 |