BioLiP

>protein
NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINK
MKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQRPH

The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ow8:C	142	127	0.9695	0.8944	1.0000	1.56e-88	3b71:A, 3b71:B, 3b71:C, 6bz3:A, 6bz3:C, 1ow6:A, 1ow6:C, 1ow7:A, 1ow7:B, 1ow7:C, 1ow8:A, 6pw8:A, 7w9u:A, 7w9u:C, 7w9u:D
2	4xev:A	148	123	0.5573	0.4932	0.5935	1.29e-46	3gm1:A, 3gm1:B, 4r32:A, 3u3f:A, 3u3f:B, 3u3f:C, 3u3f:D, 4xef:A, 4xef:D, 4xek:A, 4xev:D
3	1l5y:B	151	64	0.1221	0.1060	0.2500	1.6	1l5y:A
4	7dhw:A	726	35	0.0916	0.0165	0.3429	1.8
5	6hn0:A	583	46	0.1374	0.0309	0.3913	2.1	6hn1:A, 4jk4:A, 4jk4:B, 8kfo:B, 4luf:A, 4luh:A, 4or0:A, 4or0:B, 5orf:A, 5orf:B, 5orf:C, 5orf:D, 5osw:A, 5otb:A, 5otb:B, 5otb:C, 5otb:D, 6qs9:A, 6qs9:B, 6rjv:A, 6rjv:B, 3v03:A, 3v03:B, 8wdd:A, 8wdd:B
6	4hjf:A	263	35	0.0840	0.0418	0.3143	2.8	3u2e:A, 3u2e:B
7	7oik:A	4426	70	0.1527	0.0045	0.2857	5.4	7oim:A, 6tax:A, 6tay:A
8	8k5o:C	346	83	0.1298	0.0491	0.2048	5.4
9	1kc7:A	872	43	0.1145	0.0172	0.3488	5.8
10	8bsg:A	584	37	0.1221	0.0274	0.4324	5.9	6ock:A, 6ocl:A, 4po0:A
11	6yxx:AN	193	52	0.1069	0.0725	0.2692	6.7	7aoi:AN, 6hiv:AN, 6hix:AN, 6yxy:AN
12	6gwi:B	450	27	0.1069	0.0311	0.5185	6.7	6gwi:A
13	4rnh:A	423	14	0.0534	0.0165	0.5000	8.4

[Back]