NDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFLSFDPLTDSEKYFWFEHNKTPI
PWNYPVGVLFDCLADVLTFLRIHLVMGDSLPPTIIPIAKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVI
TRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEDVMVICQGIEIPWHMLL
YDLYSKLRSFDGFLYITLVPI
The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dym:G | 262 | 274 | 0.9425 | 0.9389 | 0.8978 | 4.14e-170 | 2dym:A, 2dym:E, 2dym:C, 3w1s:A |
2 | 7w36:A | 262 | 231 | 0.2222 | 0.2214 | 0.2511 | 8.11e-10 | |
3 | 3h9d:B | 116 | 38 | 0.0460 | 0.1034 | 0.3158 | 5.5 | |
4 | 8ulg:A | 827 | 44 | 0.0651 | 0.0206 | 0.3864 | 5.7 | 7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A |
5 | 6hyu:C | 585 | 34 | 0.0460 | 0.0205 | 0.3529 | 6.0 | |
6 | 8foc:B | 450 | 55 | 0.0690 | 0.0400 | 0.3273 | 6.2 | 6di2:A, 6di6:A, 6dtv:A, 6dtz:A, 6du0:A, 8fod:B, 8foh:B, 8foj:B, 8fok:B, 3lgb:A, 3lgb:B, 7tl2:A, 7tl3:A, 7tl4:A |
7 | 6aaf:A | 112 | 23 | 0.0421 | 0.0982 | 0.4783 | 9.6 | |
8 | 2y3a:A | 976 | 47 | 0.0421 | 0.0113 | 0.2340 | 9.9 |