NDHLVIEANINAPLGKVVNLLYGEDVSYYERILKAQKNFEISPIPNNFLTKKIRDYAYTKPLSGSIGPSKTKCLITDTLE
HYDLEDYVKVLSITKNPDVPSGNIFSVKTVFLFSWDKNNSTKLTVYNSVDWTGKSWIKSMIEKGTFDGVADTTKIMISEI
KKILS
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6cay:A | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 3.17e-119 | 6cay:B |
2 | 5ys0:B | 164 | 157 | 0.4364 | 0.4390 | 0.4586 | 1.01e-46 | 5ys0:A |
3 | 6bym:A | 200 | 171 | 0.4303 | 0.3550 | 0.4152 | 1.77e-40 | 6bym:B |
4 | 6gqf:A | 168 | 163 | 0.2121 | 0.2083 | 0.2147 | 4.76e-04 | 6gqf:B, 6gqf:C, 6gqf:D |
5 | 8tug:A | 1367 | 51 | 0.0848 | 0.0102 | 0.2745 | 1.1 | 8tvp:A, 8tvq:A, 8tvv:A, 8tvw:A, 8tvx:A |
6 | 2b4k:A | 617 | 98 | 0.1636 | 0.0438 | 0.2755 | 3.0 | 2b4k:B, 2b4k:D, 1nx9:A, 1nx9:B, 1nx9:C, 1nx9:D |
7 | 1ep1:B | 261 | 47 | 0.0848 | 0.0536 | 0.2979 | 3.0 | 1ep2:B, 1ep3:B |
8 | 5eqv:A | 336 | 32 | 0.0909 | 0.0446 | 0.4688 | 3.7 | |
9 | 3uce:A | 219 | 84 | 0.1333 | 0.1005 | 0.2619 | 3.8 | 3uce:B, 3uce:C, 3uce:D |
10 | 6ir9:W | 275 | 35 | 0.0848 | 0.0509 | 0.4000 | 8.1 | 6j4w:W, 6j4x:W, 6j4y:W, 6j4z:W, 6j50:W, 6j51:W, 8jh2:W, 7wbv:W, 7wbw:W, 7wbx:W |
11 | 2y3a:A | 976 | 86 | 0.1030 | 0.0174 | 0.1977 | 8.6 | |
12 | 5xon:W | 329 | 35 | 0.0848 | 0.0426 | 0.4000 | 9.0 |