NASTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLGPN
A
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7z0r:A | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 1.01e-57 | 7z0r:B, 7z0u:A |
2 | 2ayd:A | 76 | 62 | 0.4444 | 0.4737 | 0.5806 | 8.00e-23 | |
3 | 1wj2:A | 71 | 69 | 0.4568 | 0.5211 | 0.5362 | 3.92e-22 | 2lex:A |
4 | 8iex:A | 88 | 73 | 0.3951 | 0.3636 | 0.4384 | 1.49e-20 | |
5 | 8k31:B | 79 | 73 | 0.3951 | 0.4051 | 0.4384 | 6.97e-20 | |
6 | 6j4g:B | 58 | 60 | 0.3704 | 0.5172 | 0.5000 | 6.71e-17 | |
7 | 6j4f:B | 63 | 62 | 0.3704 | 0.4762 | 0.4839 | 2.27e-16 | 6j4f:F |
8 | 5w3x:D | 73 | 62 | 0.3457 | 0.3836 | 0.4516 | 1.28e-12 | 7p8k:B, 5w3x:B |
9 | 7d11:A | 79 | 63 | 0.3210 | 0.3291 | 0.4127 | 1.74e-12 | 6j4e:B |
10 | 6ir8:A | 69 | 59 | 0.3086 | 0.3623 | 0.4237 | 3.66e-12 | |
11 | 5w1j:A | 584 | 32 | 0.1235 | 0.0171 | 0.3125 | 2.2 | 5w1j:B, 5w1l:A, 5w1l:B |
12 | 4rdv:B | 451 | 30 | 0.1481 | 0.0266 | 0.4000 | 3.7 | 3mdu:A, 3mdw:A, 3mdw:B, 3mdw:C, 3mdw:D, 4rdv:A, 4rdv:C, 4rdv:D, 4rdw:A, 4rzb:A, 4rzb:B |
13 | 2ysm:A | 111 | 33 | 0.1481 | 0.1081 | 0.3636 | 5.3 | |
14 | 8tqm:A | 843 | 29 | 0.1358 | 0.0130 | 0.3793 | 7.9 | |
15 | 5cxy:A | 292 | 33 | 0.1481 | 0.0411 | 0.3636 | 8.5 | 5bo6:A, 5bo6:B, 5bo7:A, 5bo7:B, 5bo9:A, 5bo9:B, 5cxy:B |