BioLiP

>protein
NAMKILFSPIGNTDPWRNDRDGAMLHIVRHYQPDRVVLFFTESIWQGNQHFSGQQAFDWVKIIQSINENCQIEIKCDTIE
VENDFDAYKDLFHQYLVEEKRKYPNAEIFLNVTSGTPQMETTLCLEYVTYPDKMRCIQVSTPLTKYAQADCQEVDLEIVN
EEESQQPSRCHKIAILSFREAIVRNQIKSLLDNYDYEAALQLVASQKSFRNGKEIRKKLKELIDDIKMHRVFSYLIKQYP
RNEKLQKALLHTILLEMRHQRGDIAETLIRVKSIAEYIVEQYIQKNYPYLIIYKEDKPYFNVSYSQELTESYLALMDSGF
PAYRDFLQLLEASNEMTNEMNKVNEINNLRNKVAHNLDSLNLDRDKNGRKITNAVTAVRTMLLAVFPEVQENDFHYLKQF
NQSIKELL

The query sequence (length=408) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6tug:B	415	416	0.9926	0.9759	0.9736	0.0	6tug:A, 6tug:C, 6tug:D, 6tug:E, 6tug:F, 6tug:G, 6tug:H
2	8pe3:A	386	418	0.2770	0.2927	0.2703	5.66e-40	8pe3:B
3	8vlx:A	2431	219	0.1275	0.0214	0.2374	0.81
4	7cfd:F	182	82	0.0686	0.1538	0.3415	3.8	7cfd:B, 7cfd:A, 7cfd:C, 7cfd:E, 7cfd:G, 7cfd:H, 7cfd:D
5	2bam:B	210	72	0.0417	0.0810	0.2361	3.9	2bam:A, 3bam:A, 3bam:B, 1bhm:A, 1bhm:B, 1esg:A
6	7t3r:A	2130	206	0.1127	0.0216	0.2233	6.3	7t3r:B, 7t3r:C, 7t3r:D, 7t3t:A, 7t3t:B, 7t3t:C, 7t3t:D
7	3akk:A	296	125	0.0760	0.1047	0.2480	6.5	3akk:B, 3akk:C, 3akk:D, 3akl:A, 3akl:B, 3akl:C, 3akl:D
8	7u58:A	651	39	0.0270	0.0169	0.2821	7.0	7u58:B
9	3dzd:A	368	40	0.0343	0.0380	0.3500	7.6	3dzd:B
10	2xz7:A	324	41	0.0319	0.0401	0.3171	8.1	2xz9:A, 2xz9:B

[Back]