BioLiP

>protein
NAMKILFSPIGNTDPWRNDRDGAMLHIVRHYQPDRVVLFFTESIWQGNQHFSGQQAFDWVKIIQSINENCQIEIKCDTIE
VENDFDAYKDLFHQYLVEEKRKYPNAEIFLNVTSGTPQMETTLCLEYVTYPDKMRCIQVSTPLKTKYAQADCQEVDLEIV
NEEESQQPSRCHKIAILSFREAIVRNQIKSLLDNYDYEAALQLVASQKSFRNGKEIRKKLKELIDDIKMHRVFSYLIKQY
PRNEKLQKALLHTILLEMRHQRGDIAETLIRVKSIAEYIVEQYIQKNYPYLIIYKEDKPYFNVSYSQELTESYLALMDSG
FPAYRDFLQLLEASNEMTNEMNKVNEINNLRNKVAHNLDSLNLDRDKNGRKITNAVTAVRTMLLAVFPEVQENDFHYLKQ
FNQSIKELL

The query sequence (length=409) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6tug:B	415	417	0.9902	0.9759	0.9712	0.0	6tug:A, 6tug:C, 6tug:D, 6tug:E, 6tug:F, 6tug:G, 6tug:H
2	8pe3:A	386	418	0.2763	0.2927	0.2703	3.56e-40	8pe3:B
3	8vlx:A	2431	219	0.1271	0.0214	0.2374	0.79
4	7cfd:F	182	82	0.0685	0.1538	0.3415	3.7	7cfd:B, 7cfd:A, 7cfd:C, 7cfd:E, 7cfd:G, 7cfd:H, 7cfd:D
5	2bam:B	210	72	0.0416	0.0810	0.2361	3.9	2bam:A, 3bam:A, 3bam:B, 1bhm:A, 1bhm:B, 1esg:A
6	3akk:A	296	125	0.0758	0.1047	0.2480	6.4	3akk:B, 3akk:C, 3akk:D, 3akl:A, 3akl:B, 3akl:C, 3akl:D
7	3dzd:A	368	40	0.0342	0.0380	0.3500	7.2	3dzd:B
8	7u58:A	651	39	0.0269	0.0169	0.2821	7.2	7u58:B
9	2xz7:A	324	41	0.0318	0.0401	0.3171	8.3	2xz9:A, 2xz9:B

[Back]