NADVLAFGAHSDDVEIGMGGTIAKFVKQEKKVMICDLTEAELSSNGTVSLRKEEAAEAARILGADKRIQLTLPDRGLIMS
DQAIRSIVTVIRICRPKAVFMPYKKDRHPDHGNAAALVEEAIFSAGIHKYKDEKSLPAHKVSKVYYYMINGFHQPDFVID
ISDTIEAKKRSLNAYKSQFIPSKDSVSTPLTNGYIEIVEAREKLYGKEAGVEYAEGFFSKRMLMLDHDVLGG
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6p2t:A | 232 | 232 | 1.0000 | 1.0000 | 1.0000 | 6.27e-174 | 6ull:A |
2 | 2ixd:A | 232 | 229 | 0.6164 | 0.6164 | 0.6245 | 2.44e-100 | 2ixd:B |
3 | 3wl4:A | 267 | 227 | 0.2888 | 0.2509 | 0.2952 | 2.45e-24 | 3wl4:B, 4xm0:A, 4xm0:B, 4xm0:C, 4xm0:D, 4xm0:E, 4xm0:F, 4xm1:A, 4xm1:B, 4xm1:C, 4xm1:D, 4xm1:E, 4xm1:F, 4xm2:A, 4xm2:B, 4xm2:C, 4xm2:D, 4xm2:E, 4xm2:F |
4 | 8bgo:G | 271 | 227 | 0.2845 | 0.2435 | 0.2907 | 3.79e-23 | 8bgn:A, 8bgn:B, 8bgn:C, 8bgo:A, 8bgo:H, 8bgo:K, 8bgo:B, 8bgo:E, 8bgo:L, 8bgo:C, 8bgo:I, 8bgo:J, 8bgo:F, 8bgo:D, 8bgp:A, 8bgp:B, 8bgp:C, 8bgp:D, 8bgp:E, 8bgp:F |
5 | 5b2e:A | 267 | 228 | 0.2716 | 0.2360 | 0.2763 | 1.15e-20 | 5b2e:B, 5b2e:C, 5b2f:A, 5b2f:B, 5b2f:C, 3we7:A, 3we7:B, 3we7:C, 3wl3:A, 3wl3:B, 3wl3:C |
6 | 1q7t:A | 310 | 135 | 0.1595 | 0.1194 | 0.2741 | 0.18 | 4ewl:A, 4ewl:B, 1q74:A, 1q74:B, 1q74:C, 1q74:D, 1q7t:B |
7 | 3eps:A | 566 | 46 | 0.0733 | 0.0300 | 0.3696 | 0.83 | 3eps:B, 6k5l:A, 6k5l:B, 3lc6:A, 3lc6:B, 3lcb:A, 3lcb:B, 4p69:A, 4p69:B |
8 | 1n67:A | 332 | 86 | 0.0862 | 0.0602 | 0.2326 | 2.5 | 2vr3:A, 2vr3:B |
9 | 2i79:A | 171 | 32 | 0.0647 | 0.0877 | 0.4688 | 2.9 | 2i79:B, 2i79:C, 2i79:D, 2i79:E, 2i79:F |
10 | 7orm:A | 2145 | 108 | 0.1164 | 0.0126 | 0.2500 | 3.1 | |
11 | 6t9w:B | 383 | 160 | 0.1681 | 0.1018 | 0.2437 | 4.2 | 8bxx:AA, 8bxx:BB, 8bxx:CC, 8bxx:DD, 6t9w:A, 6t9w:C, 6t9x:B, 6t9x:A, 6t9x:C, 6t9x:D, 6tb6:B |
12 | 1svu:A | 307 | 53 | 0.0647 | 0.0489 | 0.2830 | 7.3 | |
13 | 6z8k:A | 2158 | 112 | 0.1121 | 0.0120 | 0.2321 | 7.6 | 5amq:A, 7orn:A |
14 | 6z6g:A | 2142 | 114 | 0.1164 | 0.0126 | 0.2368 | 8.2 | 5amr:A |
15 | 7ahe:C | 382 | 55 | 0.0733 | 0.0445 | 0.3091 | 8.2 | 7ahd:C, 7ahd:D, 7ahe:D, 7ahh:C, 7ahh:D |