MYVKLISSDGHEFIVKREHALTSGTIKAMLTNEVNFREIPSHVLSKVCMYFTYKVRYTNSEIPEFPIAPEIALELLMAAN
FLDC
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gmn:K | 87 | 86 | 1.0000 | 0.9655 | 0.9767 | 1.95e-57 | 3dcg:D, 3dcg:B, 6gmx:K |
2 | 2jz3:C | 96 | 96 | 1.0000 | 0.8750 | 0.8750 | 5.12e-54 | 9bju:K, 6gmn:B, 6gmx:B |
3 | 1hv2:A | 99 | 93 | 0.3929 | 0.3333 | 0.3548 | 3.17e-15 | |
4 | 8zuh:B | 137 | 88 | 0.3929 | 0.2409 | 0.3750 | 8.64e-05 | |
5 | 7w0b:A | 1586 | 62 | 0.2024 | 0.0107 | 0.2742 | 0.58 | 7w0d:F |
6 | 2vd8:A | 387 | 35 | 0.1667 | 0.0362 | 0.4000 | 2.8 | 2vd8:B, 2vd9:A, 2vd9:B |
7 | 1j1t:A | 228 | 84 | 0.2262 | 0.0833 | 0.2262 | 3.0 | 4q8k:A, 4q8l:A, 4q8l:B |
8 | 6oh9:A | 452 | 35 | 0.1667 | 0.0310 | 0.4000 | 5.1 | 6oha:A |
9 | 8gm4:A | 462 | 41 | 0.1190 | 0.0216 | 0.2439 | 7.7 | |
10 | 8fny:A | 497 | 41 | 0.1190 | 0.0201 | 0.2439 | 7.7 | 8fny:C, 8fo6:A, 8gm5:A, 7shq:A |
11 | 3acs:A | 822 | 26 | 0.1071 | 0.0109 | 0.3462 | 8.5 | 3acs:B, 3act:A, 3act:B, 3afj:A, 3afj:B, 2cqs:A, 2cqs:B, 2cqt:A, 2cqt:B, 3qfy:A, 3qfy:B, 3qfz:A, 3qfz:B, 3qg0:A, 3qg0:B |
12 | 6twi:E | 323 | 36 | 0.1786 | 0.0464 | 0.4167 | 8.7 | 4cyw:A, 4cyw:C, 4cyw:E, 4cyz:A, 4cyz:E, 4cz0:A, 4cz0:E, 4cz0:C, 4d00:A, 4d00:C, 4d00:E, 4qy1:E, 4qy1:G, 4qy1:I, 4qy1:U, 4qy2:E, 5tgu:C, 5tgu:E, 5tgu:A, 5tgv:A, 5tgv:C, 5tgv:E, 5th1:A, 5th1:C, 5th1:E, 5thc:E, 5thc:C, 6tva:A, 6tva:C, 6tva:E, 6tvb:A, 6tvb:C, 6tvb:E, 6tvd:A, 6tvd:C, 6tvd:E, 6tvd:G, 6tvd:I, 6tvd:K, 6tvf:A, 6tvf:C, 6tvf:E, 6tvf:G, 6tvf:K, 6tvf:I, 6tvr:K, 6tvs:C, 6tvs:E, 6tvs:K, 6tvt:A, 6tvt:C, 6tvt:E, 6twi:A, 6twi:C, 6twv:C, 6twv:E, 6twv:K, 6twv:G, 6twv:I, 6txo:A, 6txo:C, 6txo:E, 6ty1:A, 6ty1:C, 6ty1:E, 6ty1:G, 6ty1:I, 6ty1:K, 4xqo:A, 4xqo:C, 4xqu:A, 4xqu:C, 4xqu:E |
13 | 7dvq:Y | 140 | 28 | 0.1429 | 0.0857 | 0.4286 | 9.6 | 8i0p:Y, 8i0r:Y |