MYVKLISSDGHEFIVKREHALTSGTIKAMLSTNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLM
AANFLDC
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gmn:K | 87 | 87 | 0.9885 | 0.9885 | 0.9885 | 4.90e-59 | 3dcg:D, 3dcg:B, 6gmx:K |
2 | 2jz3:C | 96 | 96 | 1.0000 | 0.9062 | 0.9062 | 2.84e-58 | 9bju:K, 6gmn:B, 6gmx:B |
3 | 1hv2:A | 99 | 93 | 0.4023 | 0.3535 | 0.3763 | 3.89e-16 | |
4 | 8zuh:B | 137 | 86 | 0.3563 | 0.2263 | 0.3605 | 1.06e-04 | |
5 | 1j1t:A | 228 | 39 | 0.1609 | 0.0614 | 0.3590 | 3.8 | 4q8k:A, 4q8l:A, 4q8l:B |
6 | 8duj:J | 3892 | 66 | 0.2069 | 0.0046 | 0.2727 | 5.1 | |
7 | 8duj:A | 3823 | 66 | 0.2069 | 0.0047 | 0.2727 | 5.2 |