MYVKLISSDGHEFIVKREHALTSGTIKAMLSNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMA
ANFLDC
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gmn:K | 87 | 86 | 0.9884 | 0.9770 | 0.9884 | 2.45e-60 | 3dcg:D, 3dcg:B, 6gmx:K |
2 | 2jz3:C | 96 | 96 | 1.0000 | 0.8958 | 0.8958 | 2.73e-57 | 9bju:K, 6gmn:B, 6gmx:B |
3 | 1hv2:A | 99 | 93 | 0.3953 | 0.3434 | 0.3656 | 2.09e-15 | |
4 | 8zuh:B | 137 | 86 | 0.3605 | 0.2263 | 0.3605 | 1.32e-04 | |
5 | 6oh9:A | 452 | 35 | 0.1628 | 0.0310 | 0.4000 | 3.7 | 6oha:A |
6 | 2vd8:A | 387 | 35 | 0.1628 | 0.0362 | 0.4000 | 4.8 | 2vd8:B, 2vd9:A, 2vd9:B |
7 | 8gm4:A | 462 | 41 | 0.1163 | 0.0216 | 0.2439 | 5.2 | |
8 | 8fny:A | 497 | 41 | 0.1163 | 0.0201 | 0.2439 | 5.3 | 8fny:C, 8fo6:A, 8gm5:A, 7shq:A |
9 | 1j1t:A | 228 | 86 | 0.2558 | 0.0965 | 0.2558 | 5.4 | 4q8k:A, 4q8l:A, 4q8l:B |
10 | 3esw:A | 333 | 38 | 0.1279 | 0.0330 | 0.2895 | 9.7 | 1x3w:A, 1x3z:A |