BioLiP

>protein
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDLN

The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ief:A	55	53	1.0000	0.9636	1.0000	2.59e-34	2ief:B, 2ief:C, 5j0n:M, 5j0n:N, 2og0:B, 2og0:A, 6p0s:E, 6p0t:E, 6p0u:E, 6p0u:F, 1rh6:B
2	7v3u:6	646	29	0.2264	0.0186	0.4138	0.67	7qhs:6, 7v3u:F, 7v3v:6, 7v3v:F, 7w8g:6, 7w8g:F, 7z13:6, 7z13:e
3	5v8f:6	692	29	0.2264	0.0173	0.4138	1.4	8b9a:6, 8b9b:6, 8b9c:6, 6eyc:6, 3ja8:6, 8kg6:6, 8kg8:6, 8kg9:6, 7p30:6, 7p30:E, 7p5z:6, 7p5z:E, 8p5e:6, 8p62:6, 8p63:6, 7pmk:6, 7pmn:6, 6ptn:m, 6ptn:6, 6pto:l, 6pto:6, 7pt6:6, 7pt6:F, 7pt7:6, 7pt7:F, 6rqc:6, 6skl:6, 6sko:6, 6u0m:6, 5u8s:6, 8w7m:6, 8xgc:6
4	5u8t:6	661	29	0.2264	0.0182	0.4138	1.5	6wgi:6
5	8itg:A	439	16	0.1509	0.0182	0.5000	4.4	8gq9:A, 8gqa:A, 8gqb:A, 8ith:A
6	8dvs:A	682	37	0.2453	0.0191	0.3514	4.4	7bah:A, 7bah:B, 7bai:A, 7bai:B, 7bai:E, 8dvu:A, 5f9f:A, 5f9f:C, 5f9f:E, 5f9f:G, 5f9f:I, 5f9f:K, 7jl1:A, 6kyv:B, 6kyv:D, 6kyv:F, 6kyv:H, 6kyv:J, 6kyv:L, 3lrn:A, 3lrn:B, 3lrr:A, 3lrr:B, 7mk1:A, 7mk1:B, 3ncu:A, 3ncu:B, 3og8:A, 3og8:B, 2qfb:A, 2qfb:B, 2qfb:C, 2qfb:D, 2qfb:E, 2qfb:F, 2qfb:G, 2qfb:H, 2qfb:I, 2qfb:J, 7tny:A, 7tnz:A, 7to0:A, 7to2:A
7	8g7t:A	647	37	0.2453	0.0201	0.3514	5.4	4ay2:A, 4bpb:A, 8dvr:A, 8g7u:A, 8g7u:C, 8g7v:A, 8g7v:C, 8scz:A, 8sd0:A, 7tnx:A, 7to1:A, 2ykg:A, 3zd6:A
8	2h4z:A	255	23	0.1698	0.0353	0.3913	5.6	2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B
9	8fhd:A	1294	23	0.1698	0.0070	0.3913	5.6
10	6eri:Az	191	32	0.2264	0.0628	0.3750	7.2
11	4gpu:A	331	30	0.1887	0.0302	0.3333	8.0
12	6lck:A	479	14	0.1698	0.0188	0.6429	9.8	6lck:B, 6lck:C, 6lcl:A, 6lcl:C, 6lcl:E

[Back]