BioLiP

>protein
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQDQMDLMYVPVV
HSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVL
PLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGD

The query sequence (length=230) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3gp5:A	248	230	1.0000	0.9274	1.0000	3.14e-173	3fdz:A, 3gp3:A, 3gp3:B, 3gp3:C, 3gp3:D, 3gp5:B, 3gw8:A, 3gw8:B
2	1e59:A	239	228	0.6522	0.6276	0.6579	5.22e-112
3	7xb8:B	249	232	0.6174	0.5703	0.6121	1.46e-97	6isn:C, 8it4:A, 8it4:B, 8it5:C, 8it6:C, 8it7:C, 8it8:C, 8itb:C, 8itc:C, 8itd:C, 7xb7:B, 7xb7:C, 7xb8:C, 7xb9:B, 7xb9:C, 5y2i:B, 5y2u:B, 5y2u:C, 5y35:C, 5y64:C, 5y65:C, 1yfk:A, 1yjx:B, 1yjx:C, 1yjx:D, 1yjx:E, 1yjx:G, 1yjx:I, 1yjx:J, 1yjx:K, 1yjx:L, 5zrm:C, 5zs8:C
4	2h4z:A	255	234	0.5304	0.4784	0.5214	1.41e-84	2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B
5	1qhf:A	240	227	0.5217	0.5000	0.5286	7.28e-80	1bq3:D, 1bq3:A, 1bq4:A, 5pgm:E, 1qhf:B
6	4ij6:A	207	129	0.1783	0.1981	0.3178	7.51e-10	4ij6:B
7	1h2e:A	207	97	0.1522	0.1691	0.3608	2.86e-08	1h2f:A
8	5zr2:C	198	64	0.1174	0.1364	0.4219	5.94e-08	6m1x:C, 6m1x:D, 5zr2:A, 5zr2:B, 5zr2:D
9	1k6m:A	432	204	0.2087	0.1111	0.2353	1.82e-04	1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B
10	5htk:A	425	191	0.2174	0.1176	0.2618	0.005	5hr5:A, 5htk:B
11	1bif:A	432	190	0.1913	0.1019	0.2316	0.006	2bif:A, 2bif:B
12	3mbk:A	264	178	0.1739	0.1515	0.2247	0.007	3mbk:B, 8u5m:A, 8u5m:C, 8u5m:D, 8u7e:A, 8u7e:C, 8u7e:D
13	3lg2:A	269	48	0.0652	0.0558	0.3125	0.017	3lg2:B, 3lg2:C, 3lg2:D, 3ll4:A, 3ll4:B, 3oi7:A, 3oi7:B, 3oi7:C, 3oi7:D
14	2axn:A	451	205	0.2217	0.1131	0.2488	0.020	5ajv:B, 5ajw:A, 5ajx:A, 5ajy:A, 5ajz:A, 5ak0:A, 4d4j:A, 4d4k:A, 4d4l:A, 4d4m:A, 2dwo:A, 2dwp:A, 6etj:A, 6hvh:A, 6hvi:A, 6hvj:A, 2i1v:B, 6ibx:A, 6iby:A, 6ibz:A, 6ic0:A, 4ma4:A, 3qpu:A, 3qpv:A, 3qpw:A
15	1n63:B	805	33	0.0696	0.0199	0.4848	0.20	1n5w:B, 1n5w:E, 1n60:B, 1n60:E, 1n61:B, 1n61:E, 1n62:B, 1n62:E, 1n63:E, 1zxi:B, 1zxi:E
16	6b4o:A	451	100	0.1043	0.0532	0.2400	3.4	6b4o:B, 6b4o:C, 6b4o:D
17	3cew:A	118	19	0.0522	0.1017	0.6316	3.5	3cew:B, 3cew:C, 3cew:D
18	6rxt:CM	445	49	0.0652	0.0337	0.3061	4.1	5oql:d, 6rxu:CM, 6rxv:CM, 6rxx:CM, 6rxy:CM, 6rxz:CM
19	3juk:A	265	59	0.0696	0.0604	0.2712	4.3	3juk:B, 3juk:C, 3juk:D
20	4gz7:A	492	55	0.0652	0.0305	0.2727	5.6	4h00:A, 4h01:A, 4lcq:A, 4lcr:A, 4lcs:A
21	1ffu:B	797	151	0.1609	0.0464	0.2450	6.6	1ffu:E, 1ffv:B, 1ffv:E

[Back]