BioLiP

>protein
MYILDKIGLNIEILESLSYESKLGMSFKRTLSHFNKEEVLKEIELINNWYFSLEIIDDLPLDSRIKSVSSAKMKFERYYP
NATYNRVFNDILGFRVICKSYDEVLELEKEDKIRVVDMSRGKSNDDGFRGIHVYYQRDNHHYPIEIQFNTYYDRQLNDWL
HDK

The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8pu1:B	191	163	1.0000	0.8534	1.0000	4.39e-119	8pu4:A, 8pu4:B, 8pu4:C
2	1w15:A	132	60	0.1104	0.1364	0.3000	0.99
3	3fp5:A	106	36	0.0736	0.1132	0.3333	2.1
4	3iqe:A	282	40	0.0859	0.0496	0.3500	2.8	3iqe:D, 3iqe:B, 3iqe:F, 3iqe:C, 3iqe:E, 3iqf:A, 3iqf:D, 3iqf:B, 3iqf:F, 3iqf:C, 3iqf:E, 3iqf:G, 3iqf:J, 3iqf:H, 3iqf:L, 3iqf:I, 3iqf:K, 3iqz:A, 3iqz:D, 3iqz:B, 3iqz:F, 3iqz:C, 3iqz:E
5	4iub:L	602	37	0.0675	0.0183	0.2973	3.2	5d51:L, 4iuc:L, 4iud:L, 5mdj:L, 5mdk:L, 5mdl:L, 7odg:L, 7odh:L, 8pou:L, 8pov:L, 8pow:L, 8pox:L, 8poz:L, 3rgw:L, 4ttt:L
6	7tmv:A	159	57	0.1043	0.1069	0.2982	3.2	7tmv:B
7	6ewz:A	202	105	0.1472	0.1188	0.2286	3.2	6ewz:B, 6ex0:A, 6ex0:B, 6fgx:A, 6fgx:B
8	5z75:A	306	44	0.0859	0.0458	0.3182	7.4	5z75:B, 5z75:D
9	7cgv:A	310	44	0.0859	0.0452	0.3182	8.5	7cgv:B, 7cgv:C, 7cgv:D
10	1iwa:A	473	19	0.0675	0.0233	0.5789	9.9	1bwv:A, 1bwv:C, 1bwv:E, 1bwv:G, 4f0h:A, 1iwa:C, 1iwa:E, 1iwa:I, 1iwa:K, 1iwa:M, 1iwa:O

[Back]