MYGKLLICATASINVININHYIVELKQHFDEVNILFSPSSKNFINTDVLKLFCDNLYDEIKDPLLNNINIVENHEYILVL
PASANTINKIANGICDNLLTTVCLTGYQKLFIFPNMNIRMWGNPFLQKNIDLLKNNDVKVYSPDMNKSFEISSGRYKNNI
TMPNIENVLNFVLN
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1g5q:A | 174 | 174 | 1.0000 | 1.0000 | 1.0000 | 3.56e-124 | 1g5q:D, 1g5q:G, 1g5q:L, 1g63:A, 1g63:B, 1g63:H, 1g63:C, 1g63:J, 1g63:D, 1g63:F, 1g63:E, 1g63:G, 1g63:I, 1g63:L, 1g63:K |
2 | 3qjg:A | 171 | 168 | 0.5172 | 0.5263 | 0.5357 | 1.45e-64 | 3qjg:C, 3qjg:B, 3qjg:D, 3qjg:E, 3qjg:F, 3qjg:G, 3qjg:I, 3qjg:H, 3qjg:J, 3qjg:L, 3qjg:K |
3 | 5h75:D | 225 | 156 | 0.2701 | 0.2089 | 0.3013 | 2.42e-18 | 5h75:A, 5h75:B, 5h75:C, 1p3y:1 |
4 | 1e20:A | 185 | 169 | 0.2931 | 0.2757 | 0.3018 | 1.46e-15 | 1mvl:A, 1mvn:A |
5 | 7cfu:F | 175 | 169 | 0.2069 | 0.2057 | 0.2130 | 3.63e-13 | 7cfu:H, 7cfu:S, 7cfu:T, 7cfu:P, 7cfu:A, 7cfu:B, 7cfu:C, 7cfu:D, 7cfu:E, 7cfu:G, 7cfu:I, 7cfu:J, 7cfu:K, 7cfu:L, 7cfu:M, 7cfu:N, 7cfu:O, 7cfu:Q, 7cfu:R, 7cfu:U, 7cfu:V, 7cfu:W, 7cfu:X |
6 | 1qzu:A | 160 | 113 | 0.2184 | 0.2375 | 0.3363 | 3.09e-12 | 1qzu:B, 1qzu:C, 1qzu:D |
7 | 6jls:A | 162 | 144 | 0.2241 | 0.2407 | 0.2708 | 6.63e-12 | |
8 | 6tgv:C | 389 | 174 | 0.1724 | 0.0771 | 0.1724 | 3.93e-09 | 8ow5:A, 8ow5:B, 8ow5:C, 8ow5:D, 8owb:A, 8owb:B, 8owb:C, 8owb:D, 8owp:A, 8owp:B, 8owp:C, 8owp:D, 8owq:A, 8owq:B, 8owq:C, 8owq:D, 8owr:A, 8owr:C, 8owr:D, 4qji:A, 4qji:B, 6tgv:A, 6tgv:B, 6tgv:D, 6th2:A, 6th2:C, 6thc:A, 6thc:B, 6thc:C, 6thc:D |
9 | 6m8v:A | 183 | 123 | 0.2126 | 0.2022 | 0.3008 | 8.81e-07 | |
10 | 6eoa:A | 193 | 90 | 0.1207 | 0.1088 | 0.2333 | 4.62e-04 | |
11 | 6m8t:A | 189 | 46 | 0.0920 | 0.0847 | 0.3478 | 0.38 | 6m8u:A |
12 | 7vtn:A | 692 | 30 | 0.0690 | 0.0173 | 0.4000 | 0.44 | |
13 | 8fti:A | 737 | 30 | 0.0690 | 0.0163 | 0.4000 | 0.44 | 7vti:A |
14 | 3loq:A | 273 | 79 | 0.1264 | 0.0806 | 0.2785 | 2.7 | 3loq:B |
15 | 3wis:A | 180 | 24 | 0.0632 | 0.0611 | 0.4583 | 4.3 | |
16 | 2f7a:B | 213 | 90 | 0.1322 | 0.1080 | 0.2556 | 8.1 |