MWHTHSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAFTKVGQPKTLNEIKRILS
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6s6r:A | 69 | 67 | 1.0000 | 0.9710 | 1.0000 | 6.55e-45 | 5l87:A, 5l8a:A, 5l8a:B, 5l8a:C, 5l8a:D, 5n8v:A, 5n8v:B, 5n8v:D, 5n8v:F, 5oml:A, 5oml:D, 5oml:B, 5oml:C, 6rt2:A, 6rt2:D, 6rt2:B, 6rt2:C, 6s7m:A, 6s7m:B, 6s7m:C, 6s7m:D, 6s7m:H, 6s7m:E, 6spt:A |
2 | 7qrc:B | 61 | 60 | 0.5522 | 0.6066 | 0.6167 | 1.70e-21 | 7qrc:A |
3 | 4bxu:A | 69 | 47 | 0.3433 | 0.3333 | 0.4894 | 1.67e-09 | 2w84:A, 2w85:A |
4 | 3ff5:A | 54 | 45 | 0.3284 | 0.4074 | 0.4889 | 1.20e-08 | 3ff5:B |
5 | 1v1m:A | 372 | 64 | 0.2537 | 0.0457 | 0.2656 | 4.1 | 2bfb:A, 2bfc:A, 1olu:A, 1v11:A, 1v16:A, 1x7w:A, 1x7x:A, 1x7y:A, 1x80:A |
6 | 3o7j:A | 166 | 37 | 0.1791 | 0.0723 | 0.3243 | 4.6 | |
7 | 5x8p:v | 190 | 31 | 0.1791 | 0.0632 | 0.3871 | 6.1 | 5mmj:v, 5mmm:v, 5x8r:v |
8 | 2oso:A | 157 | 36 | 0.2388 | 0.1019 | 0.4444 | 6.4 | 2osd:A |
9 | 6ysl:E | 255 | 32 | 0.1493 | 0.0392 | 0.3125 | 7.4 | 6ysl:D, 6ysl:G, 6ysl:F, 6ysl:C |
10 | 6jq8:A | 225 | 25 | 0.1194 | 0.0356 | 0.3200 | 10.0 |