BioLiP

>protein
MWERDRVIVLGHRGYMSNYPENTLLAFRKAVEAGADGIELDVWLTKDGRVVVMHDETIDRTSNMKGRQKDMTLEELKKAD
VGQGERIPTLEEVFEAIPRNALVNVELKDRDAAREVAEIVAENNPERVMISSFDIDALREYRKYDDETTMGLLIDREEVV
PLIPKLKDELNLWSVNVPMEAIPLIGLEKTLQALHWVRSLGLKVVLWTENDVLFYKDDNLAKLKGLFEVVIANDVVRMIE
YLKKLGLR

The query sequence (length=248) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4oec:A	248	248	1.0000	1.0000	1.0000	0.0	4oec:B, 4oec:C, 4oec:D
2	7e2b:A	253	248	0.7621	0.7470	0.7621	4.25e-146
3	2pz0:B	243	257	0.3992	0.4074	0.3852	4.96e-41	2pz0:A
4	5t9c:E	263	233	0.2661	0.2510	0.2833	5.43e-24	5t91:A, 5t9b:G
5	4r7o:C	280	163	0.2137	0.1893	0.3252	4.09e-23	4r7o:A, 4r7o:B, 4r7o:D, 4r7o:E, 4r7o:F, 4r7o:G
6	2oog:D	268	235	0.2782	0.2575	0.2936	4.33e-22	2oog:A, 2oog:B, 2oog:C, 2oog:E, 2oog:F
7	8ghh:A	276	156	0.2177	0.1957	0.3462	2.25e-19	8ghi:A
8	7ym0:A	301	143	0.1895	0.1561	0.3287	1.31e-15	7ym0:B, 7ymr:A, 7ymr:B, 7ymr:C, 7ymr:D
9	3qvq:A	251	145	0.2016	0.1992	0.3448	1.65e-15	3qvq:B, 3qvq:C, 3qvq:D
10	3no3:A	238	230	0.2702	0.2815	0.2913	2.62e-14
11	7ww4:A	480	225	0.2379	0.1229	0.2622	1.40e-10	7wwc:A
12	3ks6:A	250	87	0.1250	0.1240	0.3563	1.21e-09	3ks5:A, 3ks5:B, 3ks6:B, 3ks6:C, 3ks6:D
13	5vug:A	268	119	0.1290	0.1194	0.2689	1.99e-08
14	1t8q:B	329	105	0.1411	0.1064	0.3333	5.15e-08	1t8q:A, 1t8q:C, 1t8q:D, 1ydy:A, 1ydy:B
15	3l12:A	297	99	0.1331	0.1111	0.3333	7.05e-07	3l12:B
16	8cwp:A	327	52	0.0927	0.0703	0.4423	3.07e-06
17	6pmp:C	617	100	0.0927	0.0373	0.2300	0.91	6pmp:A, 6pmp:B, 6pmp:D
18	6pbc:A	1070	38	0.0565	0.0131	0.3684	1.1
19	7z3j:A	1119	38	0.0565	0.0125	0.3684	1.2	2fci:A, 4k45:A, 7nxe:A, 2pld:A, 2ple:A, 5tq1:A, 5tqs:A, 5tqs:B, 5tqs:D, 5tqs:C, 1ywo:A
20	7t8t:A	1086	38	0.0565	0.0129	0.3684	1.3
21	3fzg:A	196	72	0.0645	0.0816	0.2222	1.3
22	1kae:A	434	36	0.0605	0.0346	0.4167	3.1	1kae:B, 1kah:A, 1kah:B, 1kar:A, 1kar:B
23	3ijd:A	286	51	0.0645	0.0559	0.3137	4.4	3ijd:B
24	7rei:A	243	85	0.0968	0.0988	0.2824	4.7	8u9j:A, 8u9j:B, 8uan:A
25	8t7c:A	1001	45	0.0645	0.0160	0.3556	5.4
26	3qr0:A	781	50	0.0524	0.0166	0.2600	5.9	3qr1:A, 3qr1:D
27	1nw8:A	272	44	0.0565	0.0515	0.3182	6.9	1eg2:A, 1nw5:A, 1nw6:A, 1nw7:A
28	6wn6:B	264	23	0.0484	0.0455	0.5217	7.1	6wn6:A, 6wn6:C, 6wn6:D
29	1b1y:A	500	16	0.0444	0.0220	0.6875	9.8	6f9h:A, 6f9j:A, 6f9l:A, 2xff:A, 2xfy:A, 2xg9:A, 2xgb:A, 2xgi:A

[Back]