MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIF
The query sequence (length=125) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4pki:G |
306 |
125 |
0.9920 |
0.4052 |
0.9920 |
1.24e-90 |
|
2 |
4z94:G |
307 |
125 |
0.9920 |
0.4039 |
0.9920 |
1.49e-90 |
4pkh:G, 1t44:G |
3 |
4pkg:G |
168 |
125 |
0.9920 |
0.7381 |
0.9920 |
1.37e-89 |
4pkh:B |
4 |
2fgh:A |
721 |
123 |
0.9600 |
0.1664 |
0.9756 |
8.57e-81 |
3a5l:S, 3a5m:S, 3a5n:S, 3a5o:S, 1c0f:S, 1c0g:S, 4cbu:G, 4cbw:G, 4cbx:G, 3ci5:G, 3cip:G, 3cjb:G, 3cjc:G, 1d4x:G, 1dej:S, 1eqy:S, 1esv:S, 2ff3:A, 2ff6:G, 3ffk:A, 3ffk:D, 2fgh:B, 2fh1:A, 2fh1:B, 2fh1:C, 2fh2:A, 2fh2:B, 2fh2:C, 2fh3:A, 2fh3:B, 2fh3:C, 1h1v:G, 6i4d:G, 6i4e:G, 6i4f:G, 6i4g:G, 6i4g:H, 6i4h:G, 6i4i:G, 6i4j:G, 6i4k:G, 6i4l:G, 6i4m:G, 6lje:A, 6lje:B, 6ljf:A, 6ljf:B, 1mdu:A, 1mdu:D, 5mvv:G, 1nlv:G, 1nm1:G, 1nmd:G, 1nph:A, 1p8x:A, 1p8x:B, 1p8x:C, 1p8z:G, 4pkh:E, 4pkh:J, 1rgi:G, 3tu5:B, 5ubo:S, 1yag:G, 1yvn:G, 5zz0:G, 5zz0:A |
5 |
2fgh:A |
721 |
110 |
0.3920 |
0.0680 |
0.4455 |
4.28e-19 |
3a5l:S, 3a5m:S, 3a5n:S, 3a5o:S, 1c0f:S, 1c0g:S, 4cbu:G, 4cbw:G, 4cbx:G, 3ci5:G, 3cip:G, 3cjb:G, 3cjc:G, 1d4x:G, 1dej:S, 1eqy:S, 1esv:S, 2ff3:A, 2ff6:G, 3ffk:A, 3ffk:D, 2fgh:B, 2fh1:A, 2fh1:B, 2fh1:C, 2fh2:A, 2fh2:B, 2fh2:C, 2fh3:A, 2fh3:B, 2fh3:C, 1h1v:G, 6i4d:G, 6i4e:G, 6i4f:G, 6i4g:G, 6i4g:H, 6i4h:G, 6i4i:G, 6i4j:G, 6i4k:G, 6i4l:G, 6i4m:G, 6lje:A, 6lje:B, 6ljf:A, 6ljf:B, 1mdu:A, 1mdu:D, 5mvv:G, 1nlv:G, 1nm1:G, 1nmd:G, 1nph:A, 1p8x:A, 1p8x:B, 1p8x:C, 1p8z:G, 4pkh:E, 4pkh:J, 1rgi:G, 3tu5:B, 5ubo:S, 1yag:G, 1yvn:G, 5zz0:G, 5zz0:A |
6 |
8gsu:B |
154 |
118 |
0.4880 |
0.3961 |
0.5169 |
1.60e-37 |
8gsw:B, 8gt1:B, 8gt2:B, 8gt3:B, 8gt4:B, 8gt5:B, 7w4z:B, 7w50:B, 7w51:B, 7w52:B, 7w52:D, 7w52:F, 7w52:H, 7yne:B, 7yne:D, 7yne:F, 7yne:H |
7 |
3fg6:H |
306 |
95 |
0.3040 |
0.1242 |
0.4000 |
5.14e-13 |
3fg6:A, 3fg6:C, 3fg6:G, 3fg6:E, 3fg6:F, 3fg6:D, 3fg6:B |
8 |
7whg:G |
221 |
70 |
0.1760 |
0.0995 |
0.3143 |
0.007 |
|
9 |
7whf:G |
226 |
74 |
0.1680 |
0.0929 |
0.2838 |
1.0 |
7whf:C |
10 |
6fzw:D |
180 |
48 |
0.1280 |
0.0889 |
0.3333 |
3.4 |
|
11 |
8wbd:B |
330 |
23 |
0.0800 |
0.0303 |
0.4348 |
5.2 |
8wbd:C |
12 |
8wbd:b |
352 |
23 |
0.0800 |
0.0284 |
0.4348 |
5.3 |
|
13 |
3tvi:E |
439 |
59 |
0.1200 |
0.0342 |
0.2542 |
8.3 |
3tvi:A, 3tvi:B, 3tvi:C, 3tvi:D, 3tvi:G, 3tvi:H, 3tvi:I, 3tvi:L |