MVTIDSPVAGERFEAGKDINISATVKSKTPVSKVEFYNGDTLISSDTTAPYTAKITGAAVGAYNLKAVAVLSDGRRIESP
VTPVLVKVIVKPTVKLTAPKSNVVAYGNEFLKITATASDSDGKISRVDFLVDGEVIGSDREAPYEYEWKAVEGNHEISVI
AYDDDDAASTPDSVKIFVKQARLEHHHHHH
The query sequence (length=190) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3pdd:A | 190 | 190 | 1.0000 | 1.0000 | 1.0000 | 6.36e-138 | |
2 | 4ydp:A | 83 | 49 | 0.0895 | 0.2048 | 0.3469 | 0.52 | 4ydp:B |
3 | 3ip4:B | 482 | 26 | 0.0632 | 0.0249 | 0.4615 | 2.7 | 2df4:B, 2dqn:B, 2f2a:B, 2g5h:B, 2g5i:B |
4 | 8jjr:b | 659 | 57 | 0.0737 | 0.0212 | 0.2456 | 4.2 | |
5 | 2hrl:A | 116 | 33 | 0.0737 | 0.1207 | 0.4242 | 4.9 | 2df3:A, 2g5r:A, 1o7s:A |
6 | 4bph:A | 85 | 41 | 0.0737 | 0.1647 | 0.3415 | 5.7 | |
7 | 2xts:A | 389 | 39 | 0.0737 | 0.0360 | 0.3590 | 6.4 | 2xts:C |