MVQATSRVDKCKKSDIIVSPSILSADFSRLGDEVRAIDQAGCDWVHIDVMDGRFVPNITIGPLVVEALRPVTDKVLDVHL
MIVEPELRIPDFAKAGADIISVHAEQSSTIHLHRTLNMVKDLGCKAGVVLNPGTSLSTIEEVLDVVDLILIMSVNPGFGG
QKFIESQVAKIRNLKRMCNEKGVNPWIEVDGGVTPENAYKVIDAGANALVAGSAVFKAKSYRDAIHGIKVSKAP
The query sequence (length=234) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7b1w:F | 234 | 234 | 1.0000 | 1.0000 | 1.0000 | 5.70e-173 | 7b1w:J, 7b1w:A, 7b1w:B, 7b1w:C, 7b1w:D, 7b1w:E, 7b1w:G, 7b1w:H, 7b1w:I, 7b1w:K, 7b1w:L |
2 | 1rpx:A | 230 | 229 | 0.7521 | 0.7652 | 0.7686 | 9.19e-132 | 1rpx:B, 1rpx:C |
3 | 5umf:C | 224 | 216 | 0.4402 | 0.4598 | 0.4769 | 2.57e-67 | 5umf:A, 5umf:B |
4 | 7sbj:A | 221 | 221 | 0.4915 | 0.5204 | 0.5204 | 1.79e-64 | 7sbj:B, 7sbj:C |
5 | 2fli:C | 219 | 218 | 0.4188 | 0.4475 | 0.4495 | 2.99e-64 | 2fli:A, 2fli:B, 2fli:D, 2fli:E, 2fli:F, 2fli:G, 2fli:H, 2fli:I, 2fli:J, 2fli:K, 2fli:L |
6 | 7u5y:A | 227 | 217 | 0.4231 | 0.4361 | 0.4562 | 2.72e-60 | 7u5y:B, 7u5y:C, 7u5y:D, 7u5y:E, 7u5y:F |
7 | 4nu7:C | 227 | 210 | 0.3803 | 0.3921 | 0.4238 | 1.99e-50 | 4nu7:A, 4nu7:B, 4nu7:D |
8 | 1h1y:B | 219 | 217 | 0.3632 | 0.3881 | 0.3917 | 2.70e-47 | 1h1z:A, 1h1z:B |
9 | 3qc3:A | 225 | 214 | 0.3504 | 0.3644 | 0.3832 | 7.28e-46 | 3ovp:A, 3ovp:B, 3ovq:A, 3ovq:B, 3ovr:A, 3ovr:B, 3qc3:B |
10 | 3ct7:A | 219 | 197 | 0.2906 | 0.3105 | 0.3452 | 2.11e-40 | 3ct7:B, 3ct7:C, 3ct7:D, 3ct7:E, 3ct7:F, 3ctl:A, 3ctl:B, 3ctl:C, 3ctl:D, 3ctl:E, 3ctl:F |
11 | 1tqx:A | 221 | 218 | 0.2991 | 0.3167 | 0.3211 | 1.64e-38 | 1tqx:B |
12 | 2v82:A | 205 | 51 | 0.0769 | 0.0878 | 0.3529 | 0.57 | |
13 | 3bg5:A | 1137 | 79 | 0.0812 | 0.0167 | 0.2405 | 0.86 | 3bg5:C, 8gk8:A, 8gk8:B, 3hb9:A, 3hb9:C, 3hbl:A, 3hbl:C, 4hnt:A, 4hnt:C, 4hnu:A, 4hnu:C, 4hnv:A, 4hnv:C |
14 | 3ho8:D | 934 | 79 | 0.0812 | 0.0203 | 0.2405 | 0.88 | |
15 | 3bg5:B | 1074 | 79 | 0.0812 | 0.0177 | 0.2405 | 0.93 | 3bg5:D, 8gk8:C, 3hb9:B, 3hb9:D, 3hbl:B, 3hbl:D, 4hnt:B, 4hnt:D, 4hnu:B, 4hnu:D, 4hnv:D, 3ho8:A, 3ho8:C, 3ho8:B |
16 | 4hnv:B | 1033 | 79 | 0.0812 | 0.0184 | 0.2405 | 0.97 | 8gk8:D |
17 | 8ebc:C | 355 | 35 | 0.0513 | 0.0338 | 0.3429 | 2.8 | 8ebc:A, 8ebc:B, 8ebc:D, 8ebc:F, 8ebc:E |
18 | 2iss:B | 285 | 61 | 0.0855 | 0.0702 | 0.3279 | 4.6 | 2iss:A, 2iss:C |
19 | 3rj8:A | 473 | 52 | 0.0769 | 0.0381 | 0.3462 | 5.8 | 3rja:A |
20 | 3rtx:A | 262 | 77 | 0.0897 | 0.0802 | 0.2727 | 5.9 | 3rtx:B |
21 | 4gf0:A | 208 | 47 | 0.0726 | 0.0817 | 0.3617 | 7.5 | 4gf0:B |
22 | 6zu5:SU0 | 99 | 54 | 0.0726 | 0.1717 | 0.3148 | 8.7 |