BioLiP

>protein
MVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVV
QYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPQLALWKGDTSKANLYVDDVYLVEV

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2zew:B	147	144	1.0000	0.9796	1.0000	6.79e-105	3oea:A, 3oea:B, 3oeb:A, 2zew:A, 2zex:A, 2zex:B, 2zey:B, 2zey:A
2	2zez:C	143	141	0.6111	0.6154	0.6241	4.13e-62	2zez:A, 2zez:B, 2zez:D
3	5mab:A	259	33	0.0764	0.0425	0.3333	1.7	5mab:B, 5mab:C, 5mvo:A, 5mvo:B, 5mvo:C
4	5kzw:A	850	33	0.0833	0.0141	0.3636	2.1	8cb1:A, 8cb6:A, 5kzx:A, 5nn4:A, 5nn5:A, 5nn6:A, 5nn8:A, 7p2z:AaA, 7p32:AAA
5	7ea4:A	762	71	0.1389	0.0262	0.2817	3.2	7ea4:B, 7eby:A, 7eby:B, 7eby:C, 7eby:D, 7eby:E, 7eby:F
6	5y7p:A	327	83	0.1042	0.0459	0.1807	4.8	8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F
7	4x30:A	372	35	0.1042	0.0403	0.4286	6.8	2ceo:A, 2ceo:B, 2riw:A, 2riw:B, 2xn3:A, 2xn3:B, 2xn5:A, 2xn6:A, 2xn6:B, 2xn7:A, 2xn7:B, 4yia:A, 4yia:B
8	7nds:A	294	78	0.1597	0.0782	0.2949	9.2	7ndr:D
9	7ung:HO	389	32	0.0833	0.0308	0.3750	9.9	8otz:HO, 7rro:HO, 7un1:BG

[Back]