MVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVV
QYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPELALWKGDTSKANLYVDDVYLVEV
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zew:B | 147 | 144 | 0.9931 | 0.9728 | 0.9931 | 1.71e-104 | 3oea:A, 3oea:B, 3oeb:A, 2zew:A, 2zex:A, 2zex:B, 2zey:B, 2zey:A |
2 | 2zez:C | 143 | 141 | 0.6181 | 0.6224 | 0.6312 | 1.32e-62 | 2zez:A, 2zez:B, 2zez:D |
3 | 5mab:A | 259 | 33 | 0.0764 | 0.0425 | 0.3333 | 1.7 | 5mab:B, 5mab:C, 5mvo:A, 5mvo:B, 5mvo:C |
4 | 5kzw:A | 850 | 33 | 0.0833 | 0.0141 | 0.3636 | 2.1 | 8cb1:A, 8cb6:A, 5kzx:A, 5nn4:A, 5nn5:A, 5nn6:A, 5nn8:A, 7p2z:AaA, 7p32:AAA |
5 | 5y7p:A | 327 | 83 | 0.1042 | 0.0459 | 0.1807 | 4.3 | 8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F |
6 | 4x30:A | 372 | 35 | 0.1042 | 0.0403 | 0.4286 | 6.5 | 2ceo:A, 2ceo:B, 2riw:A, 2riw:B, 2xn3:A, 2xn3:B, 2xn5:A, 2xn6:A, 2xn6:B, 2xn7:A, 2xn7:B, 4yia:A, 4yia:B |
7 | 7ung:HO | 389 | 32 | 0.0833 | 0.0308 | 0.3750 | 9.8 | 8otz:HO, 7rro:HO, 7un1:BG |