MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDG
VVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF
The query sequence (length=129) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fw5:A | 139 | 138 | 1.0000 | 0.9281 | 0.9348 | 1.06e-92 | 4fcm:A, 4fcm:B, 7suo:A, 7suo:B, 6ta7:D, 6ta7:E, 6ta7:F, 8th1:A, 8th1:B, 8th1:C, 8th1:D, 8th5:A, 8th5:C, 8th5:F, 8th5:B, 8th5:E, 8th5:D, 8th6:D, 8th6:C, 8th6:B, 8th6:A, 8th7:A, 8th7:B, 8v1l:A, 8v1l:B, 8v1l:C, 8v1l:D, 8v1l:E, 8v1l:F, 7xhf:A, 7xhf:B, 7xhg:B, 7xhg:C, 7xhg:D |
2 | 8th5:I | 119 | 129 | 0.9225 | 1.0000 | 0.9225 | 7.45e-79 | |
3 | 5drv:A | 131 | 129 | 0.8217 | 0.8092 | 0.8217 | 3.28e-77 | |
4 | 3ujm:A | 117 | 119 | 0.5814 | 0.6410 | 0.6303 | 3.89e-49 | 3ujm:B |
5 | 1gyb:B | 122 | 117 | 0.2946 | 0.3115 | 0.3248 | 1.44e-07 | 1gyb:D, 1gyb:C |
6 | 2qiy:A | 134 | 126 | 0.2248 | 0.2164 | 0.2302 | 0.001 | 2qiy:B |
7 | 8ro2:L2 | 369 | 53 | 0.1240 | 0.0434 | 0.3019 | 0.96 | 6id0:U, 6id1:U |
8 | 6uel:A | 1333 | 55 | 0.1628 | 0.0158 | 0.3818 | 2.2 | 6uel:B |
9 | 1cf7:B | 82 | 40 | 0.1008 | 0.1585 | 0.3250 | 2.3 | |
10 | 3u43:B | 132 | 80 | 0.1473 | 0.1439 | 0.2375 | 2.6 | |
11 | 7aqq:z | 233 | 64 | 0.1318 | 0.0730 | 0.2656 | 4.1 | 7a23:q, 7a23:p, 7a24:q, 7a24:p, 7ar7:z, 7ar8:z, 7arb:z, 8bef:z, 8bpx:z, 8bq5:z, 8bq6:z |
12 | 8e7f:A | 614 | 34 | 0.1008 | 0.0212 | 0.3824 | 5.7 | |
13 | 5im3:A | 874 | 59 | 0.1473 | 0.0217 | 0.3220 | 7.0 | 5im3:B |
14 | 6iih:A | 446 | 63 | 0.1318 | 0.0381 | 0.2698 | 7.2 | 6iih:B, 6lb7:B, 6xqo:J |
15 | 7w6d:A | 104 | 27 | 0.0698 | 0.0865 | 0.3333 | 9.1 | 5b09:A, 7w6d:B, 7w6e:A, 7w6e:B, 7w6f:A, 7w6f:B |
16 | 8hr8:G | 830 | 30 | 0.0930 | 0.0145 | 0.4000 | 9.2 | 8hr9:G, 8hr9:N |
17 | 8hra:C | 852 | 30 | 0.0930 | 0.0141 | 0.4000 | 9.2 | 8hr8:A, 8hr8:C, 8hr8:F, 8hr8:H, 8hr9:A, 8hr9:C, 8hr9:F, 8hr9:H, 8hr9:I, 8hr9:J, 8hr9:M, 8hr9:O, 8hra:D, 8hra:E, 8hra:H, 8hra:A, 8hra:B, 8hra:G, 8hrb:D, 8hrb:E, 8hrb:C, 8hrb:H, 8hrb:A, 8hrb:B, 8hrb:M, 8hrb:P, 8hrb:L, 8hrb:R, 8hrb:F, 8hrb:K, 8hrb:Q, 8hrb:G |