MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPI
KILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2oyn:A | 137 | 136 | 0.9926 | 0.9854 | 0.9926 | 9.94e-92 | 2vbt:A, 2vbu:A, 2vbv:A, 2vbv:B |
2 | 5trd:A | 219 | 129 | 0.3529 | 0.2192 | 0.3721 | 8.37e-20 | 5trd:B |
3 | 4o9g:A | 138 | 125 | 0.2500 | 0.2464 | 0.2720 | 0.66 | 4o9e:A, 4o9e:B, 4o9g:B, 4zu5:B, 4zu7:A, 4zu7:B, 4zu7:C, 4zu7:D, 4zu7:E, 4zu7:F, 4zu7:G, 4zu7:H |
4 | 7npa:A | 618 | 33 | 0.1103 | 0.0243 | 0.4545 | 2.7 | 7npa:B, 7npa:C, 7npa:D, 7npa:E, 7npa:F, 7npa:G, 7npa:H, 7npa:I, 7npa:J, 7npa:K, 7npa:L, 7npa:M, 7npa:N, 7npa:O, 7npa:P |
5 | 3jce:x | 586 | 59 | 0.0956 | 0.0222 | 0.2203 | 6.8 | 3deg:C |