MVKIATRKYLGKQNVYDIGVERDHNFALKNGFIASACFAHPQALSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGN
The query sequence (length=143) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
5ol7:A |
143 |
143 |
1.0000 |
1.0000 |
1.0000 |
3.13e-107 |
|
2 |
1zde:A |
160 |
99 |
0.4755 |
0.4250 |
0.6869 |
3.07e-46 |
|
3 |
1zde:A |
160 |
38 |
0.1538 |
0.1375 |
0.5789 |
9.81e-10 |
|
4 |
2imz:A |
144 |
59 |
0.1259 |
0.1250 |
0.3051 |
9.19e-06 |
5i0a:A, 3ifj:A, 3ifj:B, 3igd:A, 2imz:B, 5k08:A |
5 |
8wk4:b |
164 |
60 |
0.0979 |
0.0854 |
0.2333 |
0.48 |
7cgo:Cy, 7cgo:Ci, 7cgo:Ea, 7cgo:Ec, 7cgo:Ed, 7cgo:Ee, 7cgo:Ef, 7cgo:Cr, 7cgo:Cs, 7cgo:Ct, 7cgo:Cm, 7cgo:Cn, 7cgo:Cb, 7cgo:Cc, 7cgo:Cd, 7cgo:Ch, 7cgo:Ca, 7cgo:Eh, 7cgo:Cf, 7cgo:Cg, 7cgo:Cv, 7e81:Ea, 7e81:Ec, 7e81:Ed, 7e81:Ee, 7e81:Ef, 7e81:Cr, 7e81:Cs, 7e81:Ct, 7e81:Cm, 7e81:Cn, 7e81:Cb, 7e81:Cc, 7e81:Cd, 7e81:Ch, 7e81:Ca, 7e81:Fh, 7e81:Cf, 7e81:cg, 7e81:Cv, 8wk4:c, 8wk4:d, 8wk4:W, 8wk4:X, 8wk4:Y, 8wk4:Z, 8wk4:Q, 8wk4:R, 8wk4:S, 8wk4:T, 8wk4:L, 8wk4:M, 8wk4:N, 8wk4:F, 8wk4:G, 8wk4:H, 8wk4:A, 8wk4:B, 8wk4:g, 8wk4:h, 8wk4:a, 8wk4:U, 8wk4:V, 8wk4:O, 8wk4:I, 8wkq:AM, 8wkq:4, 8wl2:Ao, 8wl2:AV, 8wln:AM, 8wln:4, 8wln:x, 8wlt:Ao, 8wlt:AV, 8wlt:BV, 8wo5:Ao, 8wo5:AV, 8wo5:BV, 8woe:Ao, 8woe:AV |
6 |
6wil:A |
536 |
61 |
0.1469 |
0.0392 |
0.3443 |
0.50 |
|
7 |
3r6w:A |
211 |
109 |
0.1818 |
0.1232 |
0.2385 |
2.8 |
3keg:A, 3keg:B, 3lt5:A, 3lt5:B, 4n65:A, 4n65:B, 4n9q:A, 4n9q:B, 3r6w:B, 2v9c:A, 2v9c:B |
8 |
5nv3:A |
467 |
76 |
0.1399 |
0.0428 |
0.2632 |
9.0 |
5nv3:E, 5nv3:B, 5nv3:F, 5nv3:C, 5nv3:G, 5nv3:D, 5nv3:H |