MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2e76:G | 37 | 37 | 1.0000 | 1.0000 | 1.0000 | 1.11e-20 | 4h13:G, 4i7z:G, 4pv1:G |
2 | 1q90:G | 30 | 29 | 0.5405 | 0.6667 | 0.6897 | 7.86e-07 | |
3 | 7zyv:G | 34 | 34 | 0.4865 | 0.5294 | 0.5294 | 5.51e-06 | |
4 | 7zxy:G | 35 | 35 | 0.6216 | 0.6571 | 0.6571 | 0.002 | 7r0w:O, 7r0w:G, 7zxy:O |
5 | 4eis:A | 225 | 17 | 0.2703 | 0.0444 | 0.5882 | 0.43 | 4eis:B |
6 | 4nf2:A | 307 | 13 | 0.2432 | 0.0293 | 0.6923 | 2.3 | 4nf2:B, 4nf2:C |
7 | 7jwq:C | 212 | 15 | 0.1892 | 0.0330 | 0.4667 | 2.7 | 7jwp:A, 7jwp:C, 7jwp:E, 7jwp:G, 7jwp:I, 7jwp:K, 7jwp:M, 7jwp:O, 7jwq:A |
8 | 2wvk:A | 391 | 20 | 0.2432 | 0.0230 | 0.4500 | 4.9 | 2wvk:B, 2wvl:A, 2wvl:B, 2wvm:A, 2wvm:B |
9 | 6d0j:B | 396 | 33 | 0.3514 | 0.0328 | 0.3939 | 6.7 | 6d0j:A, 6d0k:A, 6d0k:B, 6d0n:A, 6d0n:B |
10 | 5thk:G | 265 | 29 | 0.3514 | 0.0491 | 0.4483 | 9.2 | 5thk:A, 5thk:B, 5thk:C, 5thk:D, 5thk:E, 5thk:F, 5thk:H |