MVAYQGLSLGLVCAVVALLLLTGNIMTHGTIAEQQMQDRLATLREVLPQSLYDNNPLADSFKVQDAELGEVEVLPARLQG
KLTAVVFQGRNIGYGGPIEQMMSVDAQGKILGVRVLTHKETPGLADKIEASRSDWIKVFDGLSLENTALDKWKVKKDGGQ
FDQFAGATITPRAVVKTVLQGLQFQARHAEQLKA
The query sequence (length=194) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ahx:G | 197 | 194 | 1.0000 | 0.9848 | 1.0000 | 2.82e-142 | 8rb8:G, 8rb9:G, 8rbm:G, 8rbq:G |
2 | 7zc6:G | 187 | 187 | 0.2990 | 0.3102 | 0.3102 | 1.13e-08 | |
3 | 8p2b:A | 83 | 90 | 0.1443 | 0.3373 | 0.3111 | 3.23e-05 | 8p2b:B |
4 | 4xhf:B | 225 | 104 | 0.1701 | 0.1467 | 0.3173 | 1.1 | 4xhf:A, 4xhf:C, 4xhf:D |
5 | 6iaa:A | 815 | 88 | 0.1340 | 0.0319 | 0.2955 | 1.2 | 6iaa:B |
6 | 6pgw:A | 427 | 36 | 0.0619 | 0.0281 | 0.3333 | 1.2 | 5co1:A, 5co1:B, 5co1:C, 5co1:D |
7 | 2y7h:B | 529 | 64 | 0.0928 | 0.0340 | 0.2812 | 2.3 | 2y7h:C |
8 | 7lj2:A | 507 | 63 | 0.0722 | 0.0276 | 0.2222 | 2.5 | 7lha:A, 7lha:B, 7lj2:B |
9 | 3lij:A | 465 | 73 | 0.1186 | 0.0495 | 0.3151 | 2.8 | 3l19:A, 3l19:B |
10 | 8bgw:A | 750 | 52 | 0.0928 | 0.0240 | 0.3462 | 5.8 | 8bgw:B, 6qq5:A, 6qq5:B, 6qq6:A, 6qq6:B, 6t6v:A |
11 | 7e24:D | 251 | 39 | 0.0722 | 0.0558 | 0.3590 | 7.2 | 7e24:A, 7e24:B, 7e24:C, 7e3x:A, 7e3x:B |
12 | 7mjr:A | 899 | 33 | 0.0619 | 0.0133 | 0.3636 | 9.8 |