MTWNFHQYYTNRNDGLMGKLVLTDEEKNNLKALRKIIRLRTRDVFEEAKGIAKAVKKSALTFEIIQEKVSTTQIKHLSDS
The query sequence (length=388) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
4u03:A |
389 |
389 |
0.9948 |
0.9923 |
0.9923 |
0.0 |
4txy:A, 4txz:A, 4ty0:A, 4u03:B, 4u0m:A, 4u0m:B, 4u0n:A, 4u0n:B, 4xj4:A |
| 2 |
4xj3:A |
369 |
388 |
0.9407 |
0.9892 |
0.9407 |
0.0 |
4txy:B, 4txz:B, 4ty0:B, 4xj5:A |
| 3 |
4xj6:A |
370 |
383 |
0.6160 |
0.6459 |
0.6240 |
1.01e-172 |
|
| 4 |
7ljo:A |
290 |
275 |
0.1881 |
0.2517 |
0.2655 |
8.74e-06 |
|
| 5 |
7ocn:A |
690 |
102 |
0.0773 |
0.0435 |
0.2941 |
0.33 |
7ocn:B, 7ocp:A, 7ocp:B, 7ocq:A, 7ocq:B, 7ocr:A, 7ocr:B, 7ocs:A, 7ocs:B, 7ocs:C, 7ocs:D, 7oct:A, 7oct:B, 7ocu:A, 7ocu:B |
| 6 |
1w2t:A |
432 |
109 |
0.0747 |
0.0671 |
0.2661 |
1.8 |
1w2t:B, 1w2t:C, 1w2t:D, 1w2t:E, 1w2t:F |
| 7 |
7bqz:A |
215 |
70 |
0.0412 |
0.0744 |
0.2286 |
2.5 |
7bqz:C, 7bqz:E, 7bqz:G, 7bu9:A, 7bu9:C, 7bu9:E, 7bu9:G, 7cna:D, 7cna:A, 7e9m:A, 7e9m:C, 7ea1:A, 8gtx:A, 4h75:A, 5jsg:A, 5jsg:B, 5jsj:A, 5jsj:B, 4mzf:B, 4mzg:B, 4mzg:D, 4mzh:A, 2ns2:A, 7ocb:B, 5y5w:A, 5y5w:C |
| 8 |
7amv:K |
708 |
41 |
0.0361 |
0.0198 |
0.3415 |
3.4 |
8c8h:K, 6rfl:K |
| 9 |
2y27:B |
427 |
44 |
0.0438 |
0.0398 |
0.3864 |
3.9 |
2y27:A, 2y4n:A, 2y4n:B |
| 10 |
7pug:A |
829 |
106 |
0.0696 |
0.0326 |
0.2547 |
5.1 |
7pxq:A |
| 11 |
4oau:C |
692 |
92 |
0.0644 |
0.0361 |
0.2717 |
5.3 |
4g8l:A, 4g8l:B, 4g8l:C, 4g8l:D, 4oav:B, 4oav:D, 1wdy:A |
| 12 |
7a19:A |
339 |
49 |
0.0387 |
0.0442 |
0.3061 |
8.6 |
7a19:B, 7a1a:A, 7a1a:B, 7wjr:A, 7wjr:B, 7wjr:C, 7wjr:D, 7wkl:A, 7wkl:B, 7wkl:C, 7wkl:D, 7wkm:A, 7wkm:B, 7wmb:A, 7wmb:B |
| 13 |
1zq1:A |
437 |
85 |
0.0464 |
0.0412 |
0.2118 |
9.2 |
1zq1:B |
| 14 |
8e4i:B |
769 |
47 |
0.0361 |
0.0182 |
0.2979 |
9.3 |
8e3j:A, 8e3j:B, 8e3p:A, 8e3p:B, 8e4i:A, 8e4k:A, 8e4k:B, 8e4z:A, 8e4z:B, 8e5u:A, 8e5u:B, 8e6g:A, 8e6g:B, 8ecw:A, 8ecw:B, 8egv:A, 8egv:B, 8ehp:A, 8ehp:B, 8eid:A, 8eid:B, 8ekn:A, 8ekn:B, 8ele:A, 8ele:B, 8epj:A, 8epj:B, 8epo:A, 8epo:B, 8epr:A, 8epr:B, 8eq7:A, 8eq7:B, 8eqx:A, 8eqx:B, 8er4:A, 8er4:B, 8etl:A, 8etl:B, 8eto:A, 8eto:B, 8eud:A, 8eud:B, 8eur:A, 8eur:B, 8eut:A, 8eut:B, 8eux:A, 8eux:B, 7r6j:A, 7r6j:B, 7rd2:A, 7rd2:B, 7rev:A, 7rev:B, 7t66:A, 7t66:B, 7t68:A, 7t68:B, 7t8v:A, 7t8v:B |
umich.edu