MTWHILGAGSLGSLWAARLGRAGLPVRLILRDRQRLRRYQQAGGLSLVEDGQASLYPIAAETPDGGQPIQRLLLACKAYD
AEEAASSVAHRLAGNAELLLLQNGLGSQQAVAARLPRSRCLFASSTEGAFRDGDFRVVFAGRGHTWLGDPRDTNAPAWLT
QLSQAGIPHSWSDDILERLWRKLALNCAINPLTVLHDCRNGGLRQHPEEIAALCDELGQLLHASGYDAAARSLLEDVRAV
IDATAANYSSMHQDVTRGRRTEIGYLLGYACQHGQRLGLPLPRLGTLLARLQAHLRQRGLPDR
The query sequence (length=303) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6k1r:A | 305 | 303 | 1.0000 | 0.9934 | 1.0000 | 0.0 | 6k1r:B, 6k1r:C, 5zix:A, 5zix:B |
2 | 2ofp:B | 294 | 299 | 0.3333 | 0.3435 | 0.3378 | 1.12e-44 | 2ofp:A, 1yjq:A, 1yon:A |
3 | 5ayv:B | 303 | 302 | 0.2937 | 0.2937 | 0.2947 | 1.20e-25 | 5ayv:A, 5hws:A, 5hws:B, 5hws:C, 5hws:D |
4 | 3hwr:A | 299 | 323 | 0.2970 | 0.3010 | 0.2786 | 7.66e-18 | 3hwr:B |
5 | 5x20:A | 312 | 311 | 0.2376 | 0.2308 | 0.2315 | 3.68e-16 | 3wfj:A, 3wfj:B, 3wfj:C, 3wfj:D, 3wfj:E, 3wfj:G, 5x20:B, 5x20:C, 5x20:D, 5x20:E |
6 | 3wfj:F | 263 | 239 | 0.1848 | 0.2129 | 0.2343 | 3.83e-09 | 3wfj:H |
7 | 8ix9:C | 314 | 300 | 0.2343 | 0.2261 | 0.2367 | 3.39e-07 | 8ix9:B, 8ix9:A, 8ixh:A, 8ixh:B, 8ixh:C, 8ixm:A, 8ixm:B |
8 | 6c6r:A | 451 | 50 | 0.0693 | 0.0466 | 0.4200 | 0.36 | 6c6n:A, 6c6n:B, 6c6p:A, 6c6p:B, 6c6r:B |
9 | 4ol9:A | 297 | 212 | 0.1749 | 0.1785 | 0.2500 | 0.53 | |
10 | 5zss:A | 388 | 45 | 0.0462 | 0.0361 | 0.3111 | 0.72 | |
11 | 3hdi:A | 414 | 58 | 0.0660 | 0.0483 | 0.3448 | 0.73 | 3hdi:B |
12 | 3k6j:A | 430 | 34 | 0.0396 | 0.0279 | 0.3529 | 1.2 | |
13 | 3rzf:A | 541 | 196 | 0.1386 | 0.0776 | 0.2143 | 2.0 | |
14 | 7v09:A | 403 | 54 | 0.0693 | 0.0521 | 0.3889 | 2.3 | 7v09:B |
15 | 8aaf:a | 848 | 64 | 0.0594 | 0.0212 | 0.2812 | 3.0 | 8agt:a, 8agu:a, 8agv:a, 8agw:a, 8agx:a, 8agz:a |
16 | 5xxb:G | 233 | 60 | 0.0594 | 0.0773 | 0.3000 | 3.2 | |
17 | 6vhy:C | 540 | 67 | 0.0660 | 0.0370 | 0.2985 | 6.5 | 6vhv:A, 6vhw:A, 6vhw:B, 6vhx:A, 6vhx:B, 6vhy:D, 6vhy:A, 6vhy:B, 6vhz:A, 6vhz:B |
18 | 3f3s:A | 312 | 85 | 0.0825 | 0.0801 | 0.2941 | 8.4 | 3f3s:B |