MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQ
QGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
The query sequence (length=159) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5etl:D | 160 | 159 | 1.0000 | 0.9938 | 1.0000 | 1.64e-117 | 6an4:A, 6an6:A, 6an6:B, 1dy3:A, 1eqm:A, 5etk:A, 5etl:A, 5etl:B, 5etl:C, 5etm:A, 5etn:A, 5eto:A, 5etp:A, 1ex8:A, 4f7v:A, 1f9h:A, 1g4c:B, 3hd1:A, 3hd2:A, 1hq2:A, 3hsd:A, 3hsd:B, 3hsg:A, 3ht0:A, 3ilj:A, 3ilo:A, 3ip0:A, 7kdo:A, 7kdr:A, 3kuh:A, 4m5g:A, 4m5h:A, 4m5i:A, 4m5j:A, 4m5k:A, 4m5l:A, 4m5m:A, 4m5n:A, 4m5n:B, 1q0n:A, 1rao:A, 1rb0:A, 1rtz:A, 1ru1:A, 1ru1:B, 1ru2:A, 8sif:A, 1tmj:A, 1tmm:A, 1tmm:B, 3ud5:A, 3ude:A, 3udv:A |
2 | 2qx0:A | 159 | 159 | 0.6226 | 0.6226 | 0.6226 | 4.56e-70 | 2qx0:B |
3 | 1cbk:A | 160 | 158 | 0.5597 | 0.5563 | 0.5633 | 6.84e-64 | 1cbk:B |
4 | 3qbc:B | 161 | 143 | 0.3648 | 0.3602 | 0.4056 | 1.05e-32 | 4ad6:A, 4ad6:B, 4crj:A, 4cwb:A, 4cyu:A, 4cyu:B, 4cyu:C, 4cyu:D, 5etq:A, 5etq:B, 5etr:B, 5etr:A, 5ets:B, 5ets:A, 5ett:B, 5ett:A, 5etv:A, 3qbc:A |
5 | 8sk1:A | 162 | 135 | 0.3648 | 0.3580 | 0.4296 | 1.41e-32 | 8sk1:B |
6 | 8sl9:A | 422 | 134 | 0.3019 | 0.1137 | 0.3582 | 3.65e-22 | 4pzv:A |
7 | 3mco:A | 397 | 137 | 0.3019 | 0.1209 | 0.3504 | 4.51e-20 | 3mcn:B, 3mco:B |
8 | 2bmb:A | 513 | 142 | 0.2893 | 0.0897 | 0.3239 | 2.67e-16 | |
9 | 3mcm:A | 368 | 134 | 0.2642 | 0.1141 | 0.3134 | 6.69e-14 | 3mcn:A |
10 | 7weg:B | 96 | 24 | 0.0755 | 0.1250 | 0.5000 | 0.61 | 7weg:A |
11 | 8jfk:B | 1033 | 34 | 0.0943 | 0.0145 | 0.4412 | 1.2 | 8jfk:N, 8jfk:J, 8jfk:F, 8jfl:B, 8jfl:N, 8jfl:F, 8jfl:J, 8xya:B |
12 | 7aor:ae | 574 | 35 | 0.0818 | 0.0226 | 0.3714 | 1.3 | |
13 | 8ebu:A | 604 | 89 | 0.1572 | 0.0414 | 0.2809 | 1.4 | 8ebt:A, 8ebx:A, 8eby:A |
14 | 7ena:6 | 652 | 89 | 0.1572 | 0.0383 | 0.2809 | 1.4 | 7ad8:A, 8bvw:0, 8ebs:A, 8ebv:A, 8ebw:A, 7egb:6, 7egc:6, 7enc:6, 8gxq:HH, 8gxs:HH, 5ivw:V, 5iy6:V, 5iy7:V, 5iy8:V, 5iy9:V, 7nvr:7, 7nvv:7, 7nvw:7, 7nvx:7, 7nvy:7, 7nvz:7, 7nw0:7, 6o9l:7, 6ro4:A, 8wak:6, 8wal:6, 8wan:6, 8wao:6, 8wap:6, 8waq:6, 8war:6, 8was:6 |
15 | 7lbm:W | 574 | 89 | 0.1572 | 0.0436 | 0.2809 | 1.5 | |
16 | 7pc5:A | 405 | 24 | 0.0755 | 0.0296 | 0.5000 | 2.8 | |
17 | 7bqo:A | 451 | 147 | 0.2264 | 0.0798 | 0.2449 | 3.4 | |
18 | 7sjr:B | 802 | 37 | 0.0881 | 0.0175 | 0.3784 | 3.9 | |
19 | 5w5j:B | 257 | 115 | 0.1950 | 0.1206 | 0.2696 | 4.3 | 5ar8:A, 5w5j:A |
20 | 6vqw:A | 80 | 58 | 0.1006 | 0.2000 | 0.2759 | 5.5 | |
21 | 5xwd:A | 611 | 87 | 0.1635 | 0.0426 | 0.2989 | 7.2 | |
22 | 4eyw:B | 634 | 77 | 0.1258 | 0.0315 | 0.2597 | 8.6 | 2deb:A, 2deb:B, 4ep9:A, 4eph:A, 4eyw:A, 2fw3:A, 2rcu:A, 2rcu:B |