MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQ
QGRVRERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5etl:D | 160 | 159 | 1.0000 | 0.9812 | 0.9874 | 5.69e-114 | 6an4:A, 6an6:A, 6an6:B, 1dy3:A, 1eqm:A, 5etk:A, 5etl:A, 5etl:B, 5etl:C, 5etm:A, 5etn:A, 5eto:A, 5etp:A, 1ex8:A, 4f7v:A, 1f9h:A, 1g4c:B, 3hd1:A, 3hd2:A, 1hq2:A, 3hsd:A, 3hsd:B, 3hsg:A, 3ht0:A, 3ilj:A, 3ilo:A, 3ip0:A, 7kdo:A, 7kdr:A, 3kuh:A, 4m5g:A, 4m5h:A, 4m5i:A, 4m5j:A, 4m5k:A, 4m5l:A, 4m5m:A, 4m5n:A, 4m5n:B, 1q0n:A, 1rao:A, 1rb0:A, 1rtz:A, 1ru1:A, 1ru1:B, 1ru2:A, 8sif:A, 1tmj:A, 1tmm:A, 1tmm:B, 3ud5:A, 3ude:A, 3udv:A |
| 2 | 2qx0:A | 159 | 159 | 0.6242 | 0.6164 | 0.6164 | 1.76e-67 | 2qx0:B |
| 3 | 1cbk:A | 160 | 157 | 0.5669 | 0.5563 | 0.5669 | 4.98e-64 | 1cbk:B |
| 4 | 8sk1:A | 162 | 134 | 0.3758 | 0.3642 | 0.4403 | 2.50e-33 | 8sk1:B |
| 5 | 3qbc:B | 161 | 142 | 0.3631 | 0.3540 | 0.4014 | 7.16e-32 | 4ad6:A, 4ad6:B, 4crj:A, 4cwb:A, 4cyu:A, 4cyu:B, 4cyu:C, 4cyu:D, 5etq:A, 5etq:B, 5etr:B, 5etr:A, 5ets:B, 5ets:A, 5ett:B, 5ett:A, 5etv:A, 3qbc:A |
| 6 | 8sl9:A | 422 | 134 | 0.2994 | 0.1114 | 0.3507 | 2.73e-20 | 4pzv:A |
| 7 | 3mco:A | 397 | 137 | 0.2994 | 0.1184 | 0.3431 | 4.12e-18 | 3mcn:B, 3mco:B |
| 8 | 2bmb:A | 513 | 140 | 0.2930 | 0.0897 | 0.3286 | 1.62e-16 | |
| 9 | 3mcm:A | 368 | 132 | 0.2675 | 0.1141 | 0.3182 | 3.73e-14 | 3mcn:A |
| 10 | 7weg:B | 96 | 24 | 0.0764 | 0.1250 | 0.5000 | 0.61 | 7weg:A |
| 11 | 8jfk:B | 1033 | 34 | 0.0955 | 0.0145 | 0.4412 | 1.2 | 8jfk:N, 8jfk:J, 8jfk:F, 8jfl:B, 8jfl:N, 8jfl:F, 8jfl:J, 8xya:B |
| 12 | 7aor:ae | 574 | 35 | 0.0828 | 0.0226 | 0.3714 | 1.2 | |
| 13 | 5yj7:C | 490 | 31 | 0.0764 | 0.0245 | 0.3871 | 1.6 | |
| 14 | 7pc5:A | 405 | 24 | 0.0764 | 0.0296 | 0.5000 | 2.7 | |
| 15 | 7ena:6 | 652 | 89 | 0.1592 | 0.0383 | 0.2809 | 3.9 | 7ad8:A, 8bvw:0, 8ebs:A, 8ebv:A, 8ebw:A, 7egb:6, 7egc:6, 7enc:6, 8gxq:HH, 8gxs:HH, 5ivw:V, 5iy6:V, 5iy7:V, 5iy8:V, 5iy9:V, 7nvr:7, 7nvv:7, 7nvw:7, 7nvx:7, 7nvy:7, 7nvz:7, 7nw0:7, 6o9l:7, 6ro4:A, 8wak:6, 8wal:6, 8wan:6, 8wao:6, 8wap:6, 8waq:6, 8war:6, 8was:6 |
| 16 | 8ebu:A | 604 | 89 | 0.1592 | 0.0414 | 0.2809 | 4.0 | 8ebt:A, 8ebx:A, 8eby:A |
| 17 | 3fgc:A | 349 | 77 | 0.1210 | 0.0544 | 0.2468 | 6.0 | |
| 18 | 5w5j:B | 257 | 109 | 0.1911 | 0.1167 | 0.2752 | 6.0 | 5ar8:A, 5w5j:A |
| 19 | 7sjr:B | 802 | 26 | 0.0764 | 0.0150 | 0.4615 | 9.0 |
umich.edu