MTTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQAN
The query sequence (length=40) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1m9o:A | 40 | 40 | 1.0000 | 1.0000 | 1.0000 | 3.22e-24 | |
2 | 1rgo:A | 70 | 34 | 0.6250 | 0.3571 | 0.7353 | 2.33e-13 | |
3 | 1rgo:A | 70 | 35 | 0.4250 | 0.2429 | 0.4857 | 4.90e-07 | |
4 | 6nzl:A | 78 | 34 | 0.4500 | 0.2308 | 0.5294 | 5.85e-07 | |
5 | 6nzl:A | 78 | 31 | 0.3500 | 0.1795 | 0.4516 | 6.42e-06 | |
6 | 6pmg:X | 35 | 30 | 0.3000 | 0.3429 | 0.4000 | 7.66e-04 | |
7 | 7dvq:M | 191 | 25 | 0.2500 | 0.0524 | 0.4000 | 0.023 | 8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M |
8 | 6ff4:t | 172 | 25 | 0.2500 | 0.0581 | 0.4000 | 0.025 | 8ch6:Z, 6ff7:t, 7qtt:Z |
9 | 7dco:M | 176 | 31 | 0.2250 | 0.0511 | 0.2903 | 0.032 | 5gm6:a |
10 | 7yb9:A | 430 | 31 | 0.3750 | 0.0349 | 0.4839 | 0.13 | 7bmi:A, 7bmj:A, 7bmj:C, 7e6j:A, 5jqy:A, 5jtc:A, 5jz6:A, 5jz8:A, 5jza:A, 5jzu:A, 6q9f:A, 6q9i:A, 6rk9:A, 6rk9:B, 7yb8:A, 7yba:A, 7ybb:A, 7ybc:A, 6yyu:A, 6yyv:A, 6yyw:A, 6yyx:A, 6yyy:A, 6z6q:A, 6z6r:A |
11 | 8y6o:V | 101 | 20 | 0.2000 | 0.0792 | 0.4000 | 0.23 | |
12 | 4ii1:B | 139 | 23 | 0.2750 | 0.0791 | 0.4783 | 0.38 | 4ii1:A, 4ii1:C, 4ii1:D |
13 | 2fc6:A | 50 | 28 | 0.2000 | 0.1600 | 0.2857 | 0.73 | |
14 | 2d9m:A | 69 | 28 | 0.3000 | 0.1739 | 0.4286 | 0.83 | |
15 | 5elh:A | 142 | 35 | 0.3750 | 0.1056 | 0.4286 | 0.94 | 5elh:B |
16 | 8cmk:A | 913 | 32 | 0.3500 | 0.0153 | 0.4375 | 2.5 | 8cmk:B, 6gx9:A, 6gx9:B |
17 | 2cqe:A | 98 | 20 | 0.2000 | 0.0816 | 0.4000 | 2.8 | |
18 | 5elk:A | 121 | 25 | 0.2500 | 0.0826 | 0.4000 | 3.1 | |
19 | 8c6j:F | 122 | 15 | 0.2000 | 0.0656 | 0.5333 | 4.1 | |
20 | 6kls:C | 236 | 26 | 0.2750 | 0.0466 | 0.4231 | 4.2 | 6kls:F, 6klv:C, 6klv:F |
21 | 2i2x:A | 459 | 26 | 0.2250 | 0.0196 | 0.3462 | 5.0 | 2i2x:C, 2i2x:E, 2i2x:G, 2i2x:I, 2i2x:K, 2i2x:M, 2i2x:O |
22 | 2wle:C | 211 | 27 | 0.2500 | 0.0474 | 0.3704 | 6.3 | 2wle:A, 2wle:B, 2wlf:A, 2wlf:C, 2wlf:B, 2wlg:A, 2wlg:C, 2wlg:B |
23 | 4cs7:C | 172 | 17 | 0.1750 | 0.0407 | 0.4118 | 7.3 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
24 | 7ndj:B | 192 | 12 | 0.1500 | 0.0312 | 0.5000 | 8.8 | 7ndi:B, 6sjd:B |