MTTLQEKIIQELGVLPTIDPKEEVRKSIDFLKAYLTKHPFLKTFVLGISGGQDSTLAGRLAQLAMTEMREETGDMSYQFI
AIRLPYGEQADEADAQAALAFIQPDVSLRVDIKPAVDAMVGSLENAGVQISDFNKGNMKARQRMITQYAVAGENAGAVIG
TDHAAENVTAFFTKYGDGGADILPLFRLNKRQGKALLKELGAPEALYLKPLVADEVALGVTYDAIDDYLEGKKVSETDQQ
TIENWYKKGQHKRHLPITIFDDFWK
The query sequence (length=265) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6c8q:A | 268 | 268 | 0.9962 | 0.9851 | 0.9851 | 0.0 | 6c8q:B, 6c8q:C, 6c8q:G, 6c8q:D, 6c8q:F, 6c8q:E, 6c8q:H |
2 | 5huh:A | 261 | 263 | 0.7434 | 0.7548 | 0.7490 | 1.51e-145 | 5huh:B |
3 | 3hmq:A | 262 | 263 | 0.6528 | 0.6603 | 0.6578 | 7.89e-125 | |
4 | 1wxi:A | 261 | 263 | 0.6377 | 0.6475 | 0.6426 | 1.05e-122 | 1wxe:A, 1wxg:A, 1wxh:A |
5 | 1ee1:A | 271 | 274 | 0.6000 | 0.5867 | 0.5803 | 1.02e-105 | 1fyd:A, 1ih8:A, 1kqp:A, 1kqp:B, 1nsy:A, 1nsy:B, 2nsy:A, 2nsy:B |
6 | 2pz8:A | 280 | 274 | 0.6038 | 0.5714 | 0.5839 | 6.46e-101 | 2pz8:B, 2pza:A, 2pza:B |
7 | 1ee1:B | 246 | 264 | 0.5698 | 0.6138 | 0.5720 | 6.12e-98 | 1ifx:A, 1ifx:B |
8 | 3q4g:A | 266 | 267 | 0.5057 | 0.5038 | 0.5019 | 2.75e-82 | |
9 | 5f23:A | 263 | 263 | 0.4868 | 0.4905 | 0.4905 | 6.38e-70 | |
10 | 3fiu:A | 238 | 248 | 0.3434 | 0.3824 | 0.3669 | 4.39e-34 | 3fiu:B, 3fiu:C, 3fiu:D |
11 | 2e18:A | 256 | 234 | 0.2792 | 0.2891 | 0.3162 | 6.90e-24 | 2e18:B |
12 | 1xng:B | 262 | 226 | 0.2340 | 0.2366 | 0.2743 | 2.90e-09 | 1xng:A |
13 | 6ofb:A | 696 | 167 | 0.1660 | 0.0632 | 0.2635 | 5.51e-05 | 6ofb:B |
14 | 5kha:A | 526 | 195 | 0.1811 | 0.0913 | 0.2462 | 0.37 | 5kha:B |
15 | 7cnr:A | 386 | 89 | 0.0868 | 0.0596 | 0.2584 | 1.3 | 7cnr:C, 7cnr:E, 7cnr:G, 7cns:A |
16 | 7d9f:A | 591 | 69 | 0.0830 | 0.0372 | 0.3188 | 2.6 | 7d9f:B, 7d9g:A, 7d9g:B, 7d9h:A, 7d9h:B, 7d9i:A, 7d9i:B, 7d9j:A, 7d9j:B |
17 | 3lbf:A | 207 | 68 | 0.0830 | 0.1063 | 0.3235 | 2.7 | 3lbf:B, 3lbf:C, 3lbf:D |
18 | 8c7s:A | 256 | 130 | 0.1245 | 0.1289 | 0.2538 | 2.9 | 8c7s:B, 5ey0:B, 5ey0:A, 5ey1:A, 5ey1:B |
19 | 5wsy:B | 165 | 76 | 0.0755 | 0.1212 | 0.2632 | 3.5 | 5wsy:A |
20 | 6ey7:B | 227 | 112 | 0.0981 | 0.1145 | 0.2321 | 5.5 | 6ey7:A, 6ey7:C, 6ey7:D, 3n4p:A, 3n4p:B, 3n4p:C, 3n4p:D, 3n4q:A, 3n4q:B, 3n4q:C, 3n4q:D |
21 | 6ofc:B | 669 | 160 | 0.1585 | 0.0628 | 0.2625 | 6.5 | 3dla:A, 3dla:D, 3dla:C, 6ofc:A, 6ofc:D, 6ofc:C, 3seq:A, 3seq:B, 3sez:A, 3sez:B, 3syt:A, 3syt:B, 3syt:C, 3szg:A, 3szg:D, 3szg:C |
22 | 3seq:D | 650 | 157 | 0.1472 | 0.0600 | 0.2484 | 7.5 | 3dla:B, 3seq:C, 3sez:D, 3sez:C, 3syt:D, 3szg:B |
23 | 5mga:A | 1182 | 31 | 0.0528 | 0.0118 | 0.4516 | 7.7 | |
24 | 6gtg:A | 1298 | 31 | 0.0528 | 0.0108 | 0.4516 | 8.0 | 6gtc:A, 6gte:A, 6gtf:A, 6i1k:A, 6i1l:A |
25 | 6gtd:A | 1269 | 31 | 0.0528 | 0.0110 | 0.4516 | 8.0 | 6i1l:D, 5nfv:A, 5ng6:A, 5ng6:C, 5ng6:E, 5ng6:G |
26 | 8q72:A | 750 | 58 | 0.0717 | 0.0253 | 0.3276 | 9.1 | 8q72:B, 8q72:F, 8q72:G |
27 | 8as8:A | 597 | 58 | 0.0717 | 0.0318 | 0.3276 | 9.9 | 8as8:B, 8bfn:A, 8bfn:B, 8bfn:F, 8bfn:G |