MTTAQHPTDEDLLARVLVPYKDHCKYLRSAVVTESAVARCEFAIPESCYIDDTGHLNSVEVNICYNQMMYYLVAKSVKEG
LLAGFESWTLDDFWKHQLPDILIARFASNFRRPVNPRAFSGEMEFQSVTRRAFLHAETAYRYWDADSGRCDGEAVLAFVN
I
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5wsy:B | 165 | 165 | 0.9876 | 0.9636 | 0.9636 | 4.44e-116 | 5wsy:A |
2 | 6c8q:A | 268 | 71 | 0.1242 | 0.0746 | 0.2817 | 4.1 | 6c8q:B, 6c8q:C, 6c8q:G, 6c8q:D, 6c8q:F, 6c8q:E, 6c8q:H |
3 | 5fzo:A | 339 | 54 | 0.1180 | 0.0560 | 0.3519 | 5.3 | 5fzo:B, 2ypd:A, 2ypd:B |