MTSFYKITAYNSQALYFWGTDADVDRYVDWLNRDREINVYAAEAIPEAEWAQYEGRDDVLSGEECGWDDF
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g9t:A | 70 | 70 | 1.0000 | 1.0000 | 1.0000 | 1.54e-47 | |
2 | 8ysx:C | 200 | 40 | 0.1857 | 0.0650 | 0.3250 | 1.3 | 8ysx:D, 8yvg:C, 8yvg:D |
3 | 7awe:L | 203 | 40 | 0.1714 | 0.0591 | 0.3000 | 1.8 | 6avo:C, 6avo:D, 7awe:Z, 7b12:L, 7b12:Z, 6e5b:K, 6e5b:Y, 3unf:K, 3unf:Y |
4 | 7lyt:A | 712 | 38 | 0.1714 | 0.0169 | 0.3158 | 2.4 | 7lys:A, 7m5o:A |
5 | 6a4r:A | 235 | 39 | 0.2000 | 0.0596 | 0.3590 | 3.3 | 6a4r:B |
6 | 8fmw:AC | 221 | 20 | 0.1286 | 0.0407 | 0.4500 | 3.3 | |
7 | 1w07:B | 658 | 38 | 0.1714 | 0.0182 | 0.3158 | 3.7 | 1w07:A |
8 | 7cep:A | 414 | 36 | 0.1143 | 0.0193 | 0.2222 | 9.0 | 7ceo:A, 7cer:A, 7ces:A, 7e6b:A, 7e6c:A, 7e6e:A, 7e6f:A, 5j8q:A, 6kfz:A, 7xej:A, 7xek:A, 7xen:A, 7xep:A, 7xet:A, 5xt5:A, 5xt5:B, 5xt6:A, 5xt6:B, 5zsk:A, 5zso:A |