MTRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEIQGANQL
LELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDGMSLQTLTQGLETFAKA
QAGL
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1u7p:A | 164 | 164 | 1.0000 | 1.0000 | 1.0000 | 1.92e-122 | 1u7p:B, 1u7p:C, 1u7p:D |
2 | 8pno:A | 202 | 110 | 0.1585 | 0.1287 | 0.2364 | 0.017 | 2b0c:A, 8pne:A, 8pno:B |
3 | 3duw:A | 220 | 83 | 0.1341 | 0.1000 | 0.2651 | 1.1 | 3duw:B |
4 | 8gs8:A | 614 | 108 | 0.1768 | 0.0472 | 0.2685 | 2.0 | 3abv:A, 3ae1:A, 3ae2:A, 3ae3:A, 3ae4:A, 3ae5:A, 3ae6:A, 3ae7:A, 3ae8:A, 3ae9:A, 3aea:A, 3aeb:A, 3aec:A, 3aed:A, 3aee:A, 3aef:A, 3aeg:A, 8dyd:A, 8dye:A, 2fbw:A, 2fbw:N, 2h88:A, 2h88:N, 2h89:A, 6myo:A, 6myp:A, 6myq:A, 6myr:A, 6mys:A, 6myt:A, 6myu:A, 3sfd:A, 3sfe:A, 6vax:A, 6vax:C, 2wqy:A, 2wqy:N, 1yq3:A, 1yq4:A, 4ytp:A, 4yxd:A, 1zoy:A, 1zp0:A |
5 | 7tm7:A | 802 | 78 | 0.1341 | 0.0274 | 0.2821 | 2.2 | 7tm7:B |
6 | 3swg:A | 417 | 38 | 0.0732 | 0.0288 | 0.3158 | 2.4 | 2yvw:A |
7 | 6xn1:B | 333 | 46 | 0.0915 | 0.0450 | 0.3261 | 3.5 | 6xn1:A, 6xn2:B, 6xn2:A |
8 | 4gox:A | 275 | 51 | 0.1037 | 0.0618 | 0.3333 | 3.8 | |
9 | 6iso:I | 248 | 26 | 0.0732 | 0.0484 | 0.4615 | 4.6 | |
10 | 6w04:A | 223 | 116 | 0.1707 | 0.1256 | 0.2414 | 8.8 |