MTRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGLLPMYTVTVD
ARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKD
EGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIGDDVL
VRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRYGIGAQILVDLGVRSMRLLTNNPADGYGLHIIERVPL
The query sequence (length=320) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4i14:A | 325 | 325 | 0.9969 | 0.9815 | 0.9815 | 0.0 | 4i14:B, 3mio:A, 3mio:B |
2 | 1tku:A | 196 | 192 | 0.3094 | 0.5051 | 0.5156 | 2.08e-59 | 2riu:A, 1tku:B |
3 | 4p6p:B | 218 | 196 | 0.2844 | 0.4174 | 0.4643 | 5.02e-57 | 4p6c:A, 4p6c:B, 4p6d:A, 4p6d:B, 4p6p:A, 4p77:A, 4p77:B, 4p8e:A, 4p8e:B, 7uf0:A, 7uf1:A, 7uf2:A, 7uf3:A, 7uf4:A, 7uf5:A |
4 | 3lqu:A | 205 | 205 | 0.2812 | 0.4390 | 0.4390 | 1.40e-50 | 1g58:A, 3lrj:A, 3lrj:B, 3lrj:C, 3lrj:D, 3ls6:A, 3ls6:B |
5 | 1k4i:A | 216 | 213 | 0.2938 | 0.4352 | 0.4413 | 9.93e-42 | 1k49:A, 1k4l:A, 1k4o:A, 1k4p:A |
6 | 1pvw:A | 219 | 221 | 0.2031 | 0.2968 | 0.2941 | 4.29e-28 | 1pvw:B, 1pvy:A, 1pvy:B, 1snn:A, 1snn:B |
7 | 2bz0:B | 173 | 170 | 0.2062 | 0.3815 | 0.3882 | 5.66e-28 | 2bz0:A, 2bz1:A |
8 | 7ej3:B | 401 | 52 | 0.0688 | 0.0549 | 0.4231 | 0.007 | 7eev:A, 7eev:B, 7ej3:A |
9 | 1f9c:A | 360 | 106 | 0.0875 | 0.0778 | 0.2642 | 1.9 | 1f9c:B, 1muc:A, 1muc:B, 2muc:A, 2muc:B, 3muc:A, 3muc:B |
10 | 7zc6:E | 194 | 31 | 0.0406 | 0.0670 | 0.4194 | 3.2 | |
11 | 7usl:C | 715 | 99 | 0.0969 | 0.0434 | 0.3131 | 3.5 | |
12 | 4lum:A | 190 | 71 | 0.0688 | 0.1158 | 0.3099 | 9.3 | 2gc0:A, 2gc0:B, 2gc1:A, 2gc1:B, 2gc2:A, 2gc2:B, 2gc3:A, 2gc3:B, 4lta:A, 4lta:B, 4luk:A, 4lul:A, 4lul:B, 4lum:B, 1qxr:A, 1qxr:B, 1qy4:A, 1qy4:B, 1x7n:A, 1x82:A |