BioLiP

>protein
MTRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGLLPMYTVTVD
ARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKD
EGSMAHTDELRVFADEHGLALITIADLIEWRRKHE

The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4i14:A	325	197	1.0000	0.6000	0.9898	4.75e-137	4i14:B, 3mio:A, 3mio:B
2	1tku:A	196	192	0.5077	0.5051	0.5156	1.36e-61	2riu:A, 1tku:B
3	4p6p:B	218	196	0.4667	0.4174	0.4643	3.38e-59	4p6c:A, 4p6c:B, 4p6d:A, 4p6d:B, 4p6p:A, 4p77:A, 4p77:B, 4p8e:A, 4p8e:B, 7uf0:A, 7uf1:A, 7uf2:A, 7uf3:A, 7uf4:A, 7uf5:A
4	3lqu:A	205	205	0.4615	0.4390	0.4390	1.35e-52	1g58:A, 3lrj:A, 3lrj:B, 3lrj:C, 3lrj:D, 3ls6:A, 3ls6:B
5	1k4i:A	216	213	0.4821	0.4352	0.4413	1.15e-43	1k49:A, 1k4l:A, 1k4o:A, 1k4p:A
6	1pvw:A	219	221	0.3333	0.2968	0.2941	7.83e-30	1pvw:B, 1pvy:A, 1pvy:B, 1snn:A, 1snn:B
7	7zc6:E	194	31	0.0667	0.0670	0.4194	2.1
8	6zhk:A	438	106	0.1179	0.0525	0.2170	5.1	6zhk:B
9	4lum:A	190	71	0.1128	0.1158	0.3099	5.3	2gc0:A, 2gc0:B, 2gc1:A, 2gc1:B, 2gc2:A, 2gc2:B, 2gc3:A, 2gc3:B, 4lta:A, 4lta:B, 4luk:A, 4lul:A, 4lul:B, 4lum:B, 1qxr:A, 1qxr:B, 1qy4:A, 1qy4:B, 1x7n:A, 1x82:A
10	2gcu:A	244	54	0.0821	0.0656	0.2963	7.7	2gcu:B, 2gcu:C, 2gcu:D

[Back]