MTRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGLLPMYAYTVT
VDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQ
KDEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIAGD
GDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRYGIGAQILVDLGVRSMRLLTNNPDGYGLHIIE
RVPLP
The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4i14:A | 325 | 325 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4i14:B, 3mio:A, 3mio:B |
2 | 1tku:A | 196 | 192 | 0.3077 | 0.5102 | 0.5208 | 5.28e-60 | 2riu:A, 1tku:B |
3 | 4p6p:B | 218 | 196 | 0.2831 | 0.4220 | 0.4694 | 8.54e-58 | 4p6c:A, 4p6c:B, 4p6d:A, 4p6d:B, 4p6p:A, 4p77:A, 4p77:B, 4p8e:A, 4p8e:B, 7uf0:A, 7uf1:A, 7uf2:A, 7uf3:A, 7uf4:A, 7uf5:A |
4 | 3lqu:A | 205 | 205 | 0.2769 | 0.4390 | 0.4390 | 9.06e-51 | 1g58:A, 3lrj:A, 3lrj:B, 3lrj:C, 3lrj:D, 3ls6:A, 3ls6:B |
5 | 1k4i:A | 216 | 213 | 0.2923 | 0.4398 | 0.4460 | 1.86e-42 | 1k49:A, 1k4l:A, 1k4o:A, 1k4p:A |
6 | 2bz0:B | 173 | 171 | 0.2062 | 0.3873 | 0.3918 | 3.97e-29 | 2bz0:A, 2bz1:A |
7 | 1pvw:A | 219 | 221 | 0.2000 | 0.2968 | 0.2941 | 2.38e-28 | 1pvw:B, 1pvy:A, 1pvy:B, 1snn:A, 1snn:B |
8 | 7ej3:B | 401 | 57 | 0.0708 | 0.0574 | 0.4035 | 0.003 | 7eev:A, 7eev:B, 7ej3:A |
9 | 2gcu:A | 244 | 80 | 0.0769 | 0.1025 | 0.3125 | 3.5 | 2gcu:B, 2gcu:C, 2gcu:D |
10 | 2eh1:B | 89 | 34 | 0.0400 | 0.1461 | 0.3824 | 3.8 | |
11 | 2raf:A | 190 | 87 | 0.0800 | 0.1368 | 0.2989 | 8.3 | |
12 | 4lum:A | 190 | 71 | 0.0677 | 0.1158 | 0.3099 | 9.5 | 2gc0:A, 2gc0:B, 2gc1:A, 2gc1:B, 2gc2:A, 2gc2:B, 2gc3:A, 2gc3:B, 4lta:A, 4lta:B, 4luk:A, 4lul:A, 4lul:B, 4lum:B, 1qxr:A, 1qxr:B, 1qy4:A, 1qy4:B, 1x7n:A, 1x82:A |