BioLiP

>protein
MTRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGLLPMTVTVDA
RNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDE
GSMAHTDELRVFADEHGLALITIADLIEWRRKHE

The query sequence (length=194) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4i14:A	325	197	1.0000	0.5969	0.9848	8.67e-136	4i14:B, 3mio:A, 3mio:B
2	1tku:A	196	192	0.5052	0.5000	0.5104	2.64e-60	2riu:A, 1tku:B
3	4p6p:B	218	196	0.4691	0.4174	0.4643	2.42e-58	4p6c:A, 4p6c:B, 4p6d:A, 4p6d:B, 4p6p:A, 4p77:A, 4p77:B, 4p8e:A, 4p8e:B, 7uf0:A, 7uf1:A, 7uf2:A, 7uf3:A, 7uf4:A, 7uf5:A
4	3lqu:A	205	205	0.4639	0.4390	0.4390	1.21e-51	1g58:A, 3lrj:A, 3lrj:B, 3lrj:C, 3lrj:D, 3ls6:A, 3ls6:B
5	1k4i:A	216	213	0.4794	0.4306	0.4366	2.96e-42	1k49:A, 1k4l:A, 1k4o:A, 1k4p:A
6	1pvw:A	219	220	0.3351	0.2968	0.2955	2.36e-29	1pvw:B, 1pvy:A, 1pvy:B, 1snn:A, 1snn:B
7	5ey5:A	261	72	0.1082	0.0805	0.2917	1.3	5ey5:C
8	6zhk:A	438	105	0.1186	0.0525	0.2190	3.2	6zhk:B
9	4lum:A	190	93	0.1392	0.1421	0.2903	3.5	2gc0:A, 2gc0:B, 2gc1:A, 2gc1:B, 2gc2:A, 2gc2:B, 2gc3:A, 2gc3:B, 4lta:A, 4lta:B, 4luk:A, 4lul:A, 4lul:B, 4lum:B, 1qxr:A, 1qxr:B, 1qy4:A, 1qy4:B, 1x7n:A, 1x82:A
10	2gcu:A	244	54	0.0825	0.0656	0.2963	7.4	2gcu:B, 2gcu:C, 2gcu:D
11	2raf:A	190	85	0.1289	0.1316	0.2941	7.9

[Back]