MTPQLQQAIRLLQLSTLELQQELQQALESNPLLEEELPVYQGETTQTLQDYLMWQVELTPFTDTDRAIATSIVDAVDDTG
YLTIQIEDIVDSIGDDEIGLEEVEAVLKRIQRFDPVGVAAKDLRDCLLIQLSQFAKETPWLEEARLIISDHLDLLANHDF
RTLMRVTRLKEEVLKEAVNLIQSLDPRPGQSIQTSEPEYVIPDVLVRKVSGRWTVELNADSIPRLKINQQYAAMGNSARN
DADGQFIRSNLQEARWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHS
PRGIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTSMLSEQGIMVARRTVAKYRESLSIPPSNQ
RKQLV
The query sequence (length=405) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7qv9:M | 417 | 405 | 0.9951 | 0.9664 | 0.9951 | 0.0 | 8f1i:M, 8f1j:M, 8f1k:M, 7qwp:M, 7qxi:M, 8re4:M, 8rea:M |
2 | 8reb:M | 350 | 367 | 0.8099 | 0.9371 | 0.8937 | 0.0 | 8rec:M, 8red:M, 8ree:M |
3 | 5nss:M | 388 | 364 | 0.7111 | 0.7423 | 0.7912 | 0.0 | 6gfw:M, 6gh5:M, 5nsr:M |
4 | 6gh6:M | 315 | 359 | 0.6642 | 0.8540 | 0.7493 | 0.0 | |
5 | 5ui5:V | 323 | 342 | 0.2395 | 0.3003 | 0.2836 | 3.88e-35 | 2o8k:A, 2o9l:A, 5ui5:I |
6 | 4u33:A | 661 | 55 | 0.0519 | 0.0318 | 0.3818 | 0.42 | 4u33:B, 4u33:C, 4u33:D, 4u33:E, 4u33:F, 4u3c:A, 4u3c:B, 4u3c:C, 4u3c:D, 4u3c:E, 4u3c:F |
7 | 3pfe:A | 471 | 47 | 0.0370 | 0.0318 | 0.3191 | 1.1 | |
8 | 5cim:B | 675 | 53 | 0.0469 | 0.0281 | 0.3585 | 1.8 | 5cgm:A, 5cgm:B |
9 | 8q4d:D | 373 | 40 | 0.0420 | 0.0456 | 0.4250 | 2.3 | 8b4h:A, 8b4h:B, 8b4h:C, 8b4h:D, 8q4d:A, 8q4d:B, 8q4d:C |
10 | 7c8j:A | 707 | 55 | 0.0321 | 0.0184 | 0.2364 | 3.3 | 7c8k:A, 8k4u:B, 8u0t:A, 7xa7:A, 7xa7:C, 7xa7:E, 7xa7:G |
11 | 8eyt:W | 254 | 32 | 0.0321 | 0.0512 | 0.4062 | 4.0 | 4adv:V, 7afo:Y, 7o5h:V |
12 | 3k2h:A | 503 | 101 | 0.0691 | 0.0557 | 0.2772 | 5.8 | 3k2h:B, 3kjr:A, 3kjr:B, 3nrr:A, 3nrr:B |
13 | 1lbg:A | 357 | 111 | 0.0691 | 0.0784 | 0.2523 | 6.5 | 2bjc:A, 2bjc:B, 1cjg:A, 1cjg:B, 1efa:A, 1efa:B, 1efa:C, 1jwl:B, 1jwl:A, 1jwl:C, 2kei:A, 2kei:B, 2kej:A, 2kej:B, 2kek:A, 2kek:B, 1l1m:A, 1l1m:B, 1lbg:D, 1lbh:A, 1lbh:B, 1lbh:C, 1lbh:D, 1lcc:A, 1lcd:A, 1osl:A, 1osl:B, 2p9h:A, 2p9h:B, 2paf:A, 2paf:B, 2pe5:A, 2pe5:B, 2pe5:C, 4rzt:A, 4rzt:B, 4rzt:C, 4rzt:D, 1tlf:A, 1tlf:B, 1tlf:C, 1tlf:D |
14 | 2nya:A | 791 | 76 | 0.0568 | 0.0291 | 0.3026 | 7.7 | 2nya:F |
15 | 7pw9:A | 1952 | 30 | 0.0247 | 0.0051 | 0.3333 | 9.0 | 7pw4:A, 7pw5:A, 7pw6:A, 7pw7:A, 7pw8:A, 6z3r:A |
16 | 6syt:A | 1896 | 30 | 0.0247 | 0.0053 | 0.3333 | 9.3 |