MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVS
FLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSS
FRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTD
PNIDYKYFDYKRTH
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bs2:F | 254 | 254 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2bs2:C, 2bs3:F, 2bs3:C, 2bs4:F, 2bs4:C, 1e7p:C, 1e7p:F, 1e7p:I, 1e7p:L, 1qlb:C, 1qlb:F |
2 | 5xmj:C | 212 | 215 | 0.2717 | 0.3255 | 0.3209 | 5.23e-27 | 5xmj:G, 5xmj:K, 5xmj:O |
3 | 6lum:D | 146 | 115 | 0.1142 | 0.1986 | 0.2522 | 1.4 | 6lum:H, 6lum:N |
4 | 7s25:A | 373 | 42 | 0.0551 | 0.0375 | 0.3333 | 2.9 | 3ndm:C, 5wnf:B, 5wng:B, 5wnh:B |
5 | 7qqb:B | 423 | 36 | 0.0630 | 0.0378 | 0.4444 | 4.4 | |
6 | 8ujg:A | 530 | 63 | 0.0709 | 0.0340 | 0.2857 | 4.7 | 8uhz:A, 8ui1:A, 8ui6:A, 8uje:A, 8ujf:A, 8ujf:B, 8ujg:B, 8ujh:A |