MTLTTVIDIGNFSTKYAYKDKKQIKVGSFPSILHSYKPLEDYEGMERVEYNGLDYYVGETVKNFYFGREEQMYFGNTRKG
HMEGQIRLVYALYTIFKETGKKEFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFKFTVHNIVMAAEGLGALNFSD
SLNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAKTCSNIDYDYPIVCTGGKAEEMKECLENVGY
STVSSAELGEDKPSYYVNSVGLLLKYGRKFEEMFA
The query sequence (length=275) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bqw:A | 275 | 275 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6bqw:B, 6bqw:C, 6bqw:D, 6bqw:E, 6bqw:F, 6bqw:G, 6bqw:H, 6bqw:I, 6f95:A, 6f95:B, 6f95:C, 6f95:D, 6f95:E |
2 | 7x54:A | 285 | 200 | 0.2109 | 0.2035 | 0.2900 | 3.41e-10 | 7x54:B, 7x54:C, 7x54:D, 7x54:E, 7x55:A, 7x55:B, 7x55:C, 7x55:D, 7x55:E, 7x56:A, 7x56:B, 7x56:C, 7x56:D, 7x56:E, 7x59:A, 7x59:B, 7x59:C, 7x59:D, 7x59:E |
3 | 4xhp:A | 723 | 234 | 0.2000 | 0.0761 | 0.2350 | 0.003 | |
4 | 4xhp:A | 723 | 215 | 0.1927 | 0.0733 | 0.2465 | 0.70 | |
5 | 8r2h:B | 701 | 126 | 0.1200 | 0.0471 | 0.2619 | 0.11 | 8r2h:A |
6 | 6qz4:A | 568 | 167 | 0.1527 | 0.0739 | 0.2515 | 0.13 | 8ekg:A, 8ekg:B, 8ekg:C, 8ekg:E, 8ekg:D, 8ekg:F, 6jtt:A, 6jtt:B, 6jtt:C, 6jtu:A, 6jtu:B, 6jtu:C, 6qg9:A, 6qg9:B, 6qg9:C, 6qg9:D, 6qg9:E, 6qg9:F, 6qg9:G, 6qg9:H, 6qg9:I, 6qg9:J, 6qga:A, 6qga:B, 6qga:C, 6qga:D, 6qga:E, 6qga:F, 6qgb:A, 6qgb:B, 6qgb:C, 6qgb:D, 6qgb:E, 6qgb:F, 6qz1:A, 6qz2:A, 6qz2:B, 6qz2:C, 6qz2:D, 6qz2:E, 6qz2:F, 6qz2:G, 6qz2:H, 6qz2:I, 6qz2:J, 6qz3:A, 6qz4:B |
7 | 4xho:A | 369 | 239 | 0.2000 | 0.1491 | 0.2301 | 0.19 | 4xe8:A, 4xhn:A |
8 | 8hmc:B | 1195 | 45 | 0.0473 | 0.0109 | 0.2889 | 4.6 | 8hmd:B |
9 | 8e56:F | 973 | 121 | 0.1200 | 0.0339 | 0.2727 | 6.2 | 8e57:F, 8e58:F, 8eog:D, 8fd7:D, 5gjw:F, 6jp5:F, 6jpa:F, 6jpb:F, 7vfs:B, 7vfu:B, 7vfv:B, 7vfw:B, 7xlq:D, 7yg5:D |
10 | 1c72:A | 217 | 63 | 0.0618 | 0.0783 | 0.2698 | 6.3 | 1c72:B, 1c72:C, 1c72:D, 1gsu:A, 1gsu:B |
11 | 1b74:A | 252 | 83 | 0.0800 | 0.0873 | 0.2651 | 7.9 |