BioLiP

>protein
MTKYKYTVEESERFNKHGIDLTVYGQVDPSATVVRVSVERGHFQEFFNVRSSYTFYVVSGQGVFYLNSEAVPAGATDLIT
VPPNTRIHYFGSMEMVLTVAPAFNEQDERHVRFISESESPY

The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5oo4:A	121	121	0.9917	0.9917	0.9917	1.29e-86	5oo5:A, 5oo8:A, 5oo9:A, 5ooa:A
2	4h7l:B	117	62	0.1405	0.1453	0.2742	0.53	4h7l:A
3	1o4t:A	115	25	0.0826	0.0870	0.4000	2.0	1o4t:B
4	4e2q:A	258	43	0.1074	0.0504	0.3023	2.0	4e2q:B, 4e2q:C, 4e2q:D, 4e2q:E, 4e2q:F, 4e2q:G, 4e2q:H, 4e2q:I, 4e2q:J, 4e2q:K, 4e2q:L, 4e2q:M, 4e2q:N, 4e2q:O, 4e2q:P, 4e2s:A, 4e2s:B, 4e2s:C, 4e2s:D, 4e2s:E, 4e2s:F, 4e2s:G, 4e2s:H, 4e2s:I, 4e2s:J, 4e2s:K, 4e2s:L, 4e2s:M, 4e2s:N, 4e2s:O, 4e2s:P
5	7pay:A	329	58	0.1322	0.0486	0.2759	2.4	7pax:A, 7pb0:A, 7pb1:A, 6w2l:A, 6z1n:A
6	2h0v:A	335	44	0.0992	0.0358	0.2727	4.1	2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B
7	3vss:A	494	43	0.1157	0.0283	0.3256	5.1
8	7zyb:A	112	67	0.1653	0.1786	0.2985	5.2	7zyc:A
9	7zcu:B	46	22	0.0992	0.2609	0.5455	5.8	7zcu:D, 7zcu:N, 7zcu:H, 7zcu:L, 7zcu:P, 7zcu:J, 7zcu:R, 7zcu:F
10	6kqx:A	327	24	0.0744	0.0275	0.3750	8.1
11	7vlb:B	353	24	0.0744	0.0255	0.3750	8.3
12	7zvy:A	112	64	0.1405	0.1518	0.2656	9.2

[Back]