BioLiP

>protein
MTKLILIRAGETEWNLLGKIQGCTDIELTPNGIQQANEVAQQIKGNFDIIYSSPLHRALITAQKIAGDKEVHLIEGMKEI
PFGTWEGHTFEELNGDINYKKFLSGEDGCPFDSTGMSIASWSKKNAQLLLDLCKQNENKTIVCVSHGAWIKTSILGLLEM
EPTMYHKFQLGNTGITTFIFRHGHPVLTSFNSTQHLLT

The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5zr2:C	198	198	1.0000	1.0000	1.0000	2.01e-148	6m1x:C, 6m1x:D, 5zr2:A, 5zr2:B, 5zr2:D
2	4ij6:A	207	201	0.3232	0.3092	0.3184	2.83e-26	4ij6:B
3	1h2e:A	207	156	0.2273	0.2174	0.2885	1.92e-13	1h2f:A
4	4pza:B	217	157	0.2121	0.1935	0.2675	4.88e-09	4pza:A, 4qih:A, 4qih:B
5	3gp5:A	248	64	0.1364	0.1089	0.4219	5.42e-08	3fdz:A, 3gp3:A, 3gp3:B, 3gp3:C, 3gp3:D, 3gp5:B, 3gw8:A, 3gw8:B
6	1e59:A	239	64	0.1162	0.0962	0.3594	2.96e-07
7	7xb8:B	249	62	0.1212	0.0964	0.3871	1.49e-06	6isn:C, 8it4:A, 8it4:B, 8it5:C, 8it6:C, 8it7:C, 8it8:C, 8itb:C, 8itc:C, 8itd:C, 7xb7:B, 7xb7:C, 7xb8:C, 7xb9:B, 7xb9:C, 5y2i:B, 5y2u:B, 5y2u:C, 5y35:C, 5y64:C, 5y65:C, 1yfk:A, 1yjx:B, 1yjx:C, 1yjx:D, 1yjx:E, 1yjx:G, 1yjx:I, 1yjx:J, 1yjx:K, 1yjx:L, 5zrm:C, 5zs8:C
8	1qhf:A	240	63	0.1212	0.1000	0.3810	5.36e-06	1bq3:D, 1bq3:A, 1bq4:A, 5pgm:E, 1qhf:B
9	1bif:A	432	160	0.2121	0.0972	0.2625	7.27e-05	2bif:A, 2bif:B
10	2h4z:A	255	63	0.1061	0.0824	0.3333	9.66e-05	2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B
11	3lg2:A	269	107	0.1515	0.1115	0.2804	1.45e-04	3lg2:B, 3lg2:C, 3lg2:D, 3ll4:A, 3ll4:B, 3oi7:A, 3oi7:B, 3oi7:C, 3oi7:D
12	1k6m:A	432	160	0.2071	0.0949	0.2562	0.002	1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B
13	3d1l:B	259	104	0.1313	0.1004	0.2500	0.049
14	4v3p:Lg	120	47	0.0808	0.1333	0.3404	0.071	8ip8:SA, 8ipa:SA, 8ipb:SA, 8jiv:Cd, 4v7e:Cd
15	5htk:A	425	158	0.1869	0.0871	0.2342	0.13	5hr5:A, 5htk:B
16	2axn:A	451	160	0.2020	0.0887	0.2500	0.32	5ajv:B, 5ajw:A, 5ajx:A, 5ajy:A, 5ajz:A, 5ak0:A, 4d4j:A, 4d4k:A, 4d4l:A, 4d4m:A, 2dwo:A, 2dwp:A, 6etj:A, 6hvh:A, 6hvi:A, 6hvj:A, 2i1v:B, 6ibx:A, 6iby:A, 6ibz:A, 6ic0:A, 4ma4:A, 3qpu:A, 3qpv:A, 3qpw:A
17	7c9r:C	311	102	0.1263	0.0804	0.2451	1.8
18	6d4b:A	361	70	0.1010	0.0554	0.2857	2.4	6d4b:B, 6d4c:A, 6d4c:B, 5dn9:A, 5dn9:B
19	4r1m:A	435	44	0.0606	0.0276	0.2727	4.2	4r1l:A, 4r1l:B, 4r1l:C, 4r1l:D, 4r1m:B, 4r1m:C, 4r1m:D, 4rvn:A, 4rvn:B, 4rvn:C, 4rvn:D, 4rvo:A, 4rvo:B, 4rvo:C, 4rvo:D
20	1dq3:A	454	61	0.1212	0.0529	0.3934	4.8
21	6lod:B	929	39	0.0657	0.0140	0.3333	7.5	6loe:B

[Back]