BioLiP

>protein
MTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSKDEGQKVSFTIESGAKAPAAGNVTSL

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ot5:B	66	66	1.0000	1.0000	1.0000	1.51e-43
2	2es2:A	67	64	0.5758	0.5672	0.5938	2.44e-21	3pf4:B, 3pf5:B, 3pf5:A
3	1c9o:A	66	64	0.5606	0.5606	0.5781	8.59e-21	1c9o:B, 2hax:A, 2hax:B
4	7oii:B	39	39	0.4848	0.8205	0.8205	1.01e-18
5	6a6j:A	90	68	0.4242	0.3111	0.4118	1.78e-11	6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A
6	7f3i:A	93	68	0.4242	0.3011	0.4118	3.21e-11	7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A
7	5udz:A	139	70	0.4242	0.2014	0.4000	3.03e-10	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
8	4a75:A	89	70	0.4091	0.3034	0.3857	7.28e-10	4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D
9	5xgu:A	631	36	0.2273	0.0238	0.4167	0.14	5xgu:B
10	5o2w:A	248	47	0.2273	0.0605	0.3191	0.35	5o2x:A
11	8cdu:C	708	52	0.2424	0.0226	0.3077	0.54	8cec:C, 8ced:C, 8cee:C
12	6snh:X	479	37	0.1818	0.0251	0.3243	2.2	6sni:X
13	1yw1:A	393	43	0.2424	0.0407	0.3721	3.7
14	3gri:B	423	51	0.2576	0.0402	0.3333	3.8	3gri:A
15	6asl:A	430	43	0.2424	0.0372	0.3721	4.7
16	6zcv:A	562	40	0.1818	0.0214	0.3000	5.0	6zcw:A
17	7pnv:D	343	37	0.2121	0.0408	0.3784	5.2	7pnt:D, 7pnu:D, 7pnw:D
18	7c5x:A	506	20	0.1364	0.0178	0.4500	7.1	7c5x:B
19	5l8e:A	517	42	0.1667	0.0213	0.2619	7.7
20	1rbo:L	467	45	0.1970	0.0278	0.2889	7.8	1aa1:L, 1aa1:B, 1aa1:E, 1aa1:H, 1aus:L, 1aus:M, 1aus:N, 1aus:O, 3axk:A, 3axk:B, 1ej7:L, 1ir1:A, 1ir1:B, 1ir1:C, 1ir1:D, 5iu0:A, 5iu0:B, 8qj0:L, 8qj0:M, 8qj0:N, 8qj0:O, 1rbo:B, 1rbo:E, 1rbo:H, 1rco:L, 1rco:B, 1rco:E, 1rco:H, 1rco:K, 1rco:O, 1rco:R, 1rco:V, 1rcx:L, 1rcx:B, 1rcx:E, 1rcx:H, 1rcx:K, 1rcx:O, 1rcx:R, 1rcx:V, 4rub:A, 4rub:D, 4rub:B, 4rub:C, 8ruc:A, 8ruc:C, 8ruc:E, 8ruc:G, 1rxo:L, 1rxo:B, 1rxo:E, 1rxo:H, 1upm:B, 1upm:L, 1upm:E, 1upm:H, 1upm:K, 1upm:O, 1upm:R, 1upm:V, 1upp:A, 1upp:C, 1upp:E, 1upp:G, 1wdd:A, 1wdd:E, 5wsk:A, 5wsk:B, 5wsk:C, 5wsk:D
21	6gdd:A	375	26	0.1515	0.0267	0.3846	8.3	6gde:A, 6gdf:A, 1xrf:A, 1xrt:A, 1xrt:B
22	4bjh:A	422	26	0.1515	0.0237	0.3846	8.4	3d6n:A
23	5kjq:A	180	29	0.1970	0.0722	0.4483	9.0	3x2g:A, 3x2h:A, 3x2i:A, 3x2k:A, 3x2l:A, 3x2m:A, 3x2p:A
24	4q2t:A	590	28	0.2273	0.0254	0.5357	9.2	4q2t:B, 4q2x:A, 4q2x:B

[Back]