BioLiP

>protein
MTGDFVLPELEDVRAEAATVDTRAVLALAEGEEPAESRAAVALALWEDRSIGTAELQAAAEARCGARRPRLHTFVPLYTT
NYCDSECKMCSMRKGNHRLDRKFSGRKEITEQLEILYHHEGVRGVGFLTGEYEDKHTRLASAFRIGWAIRTALDLGFERV
YFNIGSMEQDEIDVLGEWIGREDPVTMCVFQESYDRETYRRFMGKTSVGVPKADFDRRVVSFDRWLDAGYRYVNPGVLVG
LHDDLSAELVSLVAHGDHLRSRGATADLSVPRMRPAMKSRDTTRVGDDDYLRLMSVVAFTCPEQRLVLTTREPQEFQDVA
LGLAGVISPGSPDVAPYRAGCEARNDEKSSQFLVADLRRPRHILGRIEASGTPVDHFVNPA

The query sequence (length=381) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6htk:A	384	379	0.9948	0.9870	1.0000	0.0	6htk:B, 6htm:A, 6htm:B, 6hto:A, 6hto:B, 4r33:A, 4r33:B, 4r34:A, 4r34:B
2	4wcx:A	454	362	0.2572	0.2159	0.2707	1.46e-26	4wcx:C
3	4rtb:A	429	277	0.2100	0.1865	0.2888	3.62e-24
4	7pd1:B	367	305	0.2257	0.2343	0.2820	1.26e-15	7pd1:A, 7pd2:A, 7pd2:B
5	3t7v:A	337	200	0.1417	0.1602	0.2700	0.017
6	7o1o:A	356	109	0.0709	0.0758	0.2477	1.9	3ciw:A, 3cix:A, 5fep:A, 5fes:A, 5few:A, 5fex:A, 5fez:A, 5ff0:A, 5ff2:A, 5ff3:A, 5ff4:A, 3iix:A, 3iiz:A, 4jxc:A, 4jy8:A, 4jy9:A, 4jyd:A, 4jye:A, 4jyf:A, 7o1p:A, 7o1s:A, 7o1t:A, 7o25:A, 7o26:A, 8qmk:A, 8qml:A, 8qmm:A, 8qmn:A
7	1qwj:B	229	44	0.0472	0.0786	0.4091	2.4	1qwj:A, 1qwj:C, 1qwj:D
8	6wmp:D	1159	189	0.1181	0.0388	0.2381	2.5	6wmr:D, 6wmt:D
9	8b9d:4	677	58	0.0420	0.0236	0.2759	3.0	7pfo:4, 7plo:4
10	7w1y:4	653	58	0.0420	0.0245	0.2759	3.0	7w1y:C, 6xtx:4, 6xty:4
11	8bux:A	289	83	0.0577	0.0761	0.2651	3.6
12	2mgz:A	94	52	0.0420	0.1702	0.3077	4.9
13	8a0m:B	964	51	0.0446	0.0176	0.3333	7.2
14	8a0c:A	1116	51	0.0446	0.0152	0.3333	7.3	8a0c:B, 8a0m:A, 8a0m:C
15	8a0m:D	975	51	0.0446	0.0174	0.3333	7.4

[Back]