MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGA
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2d2c:F | 35 | 32 | 1.0000 | 0.9143 | 1.0000 | 8.50e-16 | 2d2c:S, 2e74:F, 2e75:F, 2e76:F, 4h0l:F, 4h13:F, 4i7z:F, 4pv1:F, 1vf5:F, 1vf5:S |
| 2 | 4h44:F | 32 | 32 | 0.8125 | 0.8125 | 0.8125 | 5.31e-11 | 4ogq:F, 2zt9:F |
umich.edu